Paola Bocale, Khrystyna Krychkovska - Involving epistemic uncertainty in Ukrainian. The use of non-proximal deictics in contexts

In Ukrainian there is a tendency for non-proximal deictics to correlate with lower degrees of epistemic certainty. This work will concentrate on the Ukrainian to, which appears in the apodosis of conditional sentences and is derived from a non-proximal demonstrative meaning ‘that’. The conditional connective to combines with a range of subordinating conjunctions, including jakščo, jakby ‘if’, koly ‘when’, and oskil′ky ‘since’.

The main question addressed by this study is how the semantics of distal deictics can account for their interaction with a range of non-factual, hypothetical or less certain environments. In order to explain the correlation of spatial distance with epistemic distance, or how the spatial relationship is transferred to the modal domain, we will draw upon theories of understanding as establishing physical closeness (Jäkel 1995), and upon Deictic Space Theory (Chilton 2014), a cognitive linguistic theory which captures spatial, temporal and modal conceptualisations through a three-dimensional abstract space in which axes represent distance from the speaker's deictic centre.

Understanding can be conceptualised metaphorically as spatially approaching an idea object. In the process of understanding, the metaphorical distance between thinker and idea object is gradually reduced. The thinker’s capacity to understand is metaphorically conceptualised as the ability to reduce the space in between the mind container and the idea object. Both mental closeness and mental distance are set in spatial dimensions, i.e. ‘mental closeness is spatial closeness, and mental distance is spatial distance’ (Jäkel 1995: 216). The methaphorical conceptualisation of understanding as a process involving a spatial dimension, i.e. closeness vs. distance, is relevant in the analysis of the role that Ukrainian distal deictics may play in conveying epistemic uncertainty. Epistemic uncertainty can be viewed as an actualization of distance from the speaker’s understanding, certainty and reality. Cognitive analyses of metaphors relating to mental activity show that not understanding or misunderstanding are conceptualised as spatial distance. The use of distal deictics in contexts involving epistemic distancing can thus be related to the metaphoric spatial conceptualisation of mental activity.

Besides, the notion of epistemic uncertainty as the furthest point on modality axis intersecting with distance and time axes proposed by Deictic Space Theory fits well with the analysis of Ukrainian non-proximal deictics. In DST the modality axis models epistemic distance from the speaker and points only in direction away from the deictic centre, ranging from the epistemic judgement of certainty to counterfactuality. Discourse entities that are conceptualised as having a higher level of certainty are spatially more proximal to the speaker and, conversely, those with lower level of certainty are conceived as distal. What on the modality axis is conceived as remote is also uncertain. The modality axis thus encodes the speaker's commitment to the truth or factuality of an assertion that a state of affairs will occur or commitment to the truth of a proposition. By postulating that for speakers what is close corresponds to what is most real, and what is maximally distal corresponds to what is counterfactual, negated or unreal, DST creates a correlation between spatial distance and epistemic distance that is extremely useful in evaluating the function that Ukrainian distal deictics hold in those contexts where they not only have their primary function of marking spatial or temporal reference, but are also involved in epistemic meaning.  

Chilton, P. 2014. Language, space and mind. The conceptual geometry of linguistic meaning. Cambridge: Cambridge University Press.

Jäkel, O. 1995. The metaphorical concept of mind: ‘Mental activity is manipulation’. In J. R. Taylor & R. E. MacLaury. (eds), Language and the Cognitive Construal of the World. Berlin et al.: Mouton de Gruyter, 197-229.

 

Manuel Boschiero, Giorgia Pomarolli, Luisa Ruvoletto - Verso una didattica accessibile del russo LS: proposta per l’organizzazione di un corso online di lingua russa per principianti assoluti

Il presente contributo intende illustrare la struttura e i contenuti di un corso online di lingua russaper principianti assoluti attualmente in fase di progettazione che si svolgerà nei mesi di ottobre e novembre 2020. Il corso è organizzato nell’ambito del progetto di ricerca “Per una didattica accessibile e inclusiva della lingua russa. Uno studio sperimentale”, condotto da un gruppo di ricerca afferente al Dipartimento di Lingue e Letterature Straniere dell’Università di Verona.

La recente situazione straordinaria legata all’emergenza Covid-19 ha imposto una riflessione generale sulle potenzialità, sostenibilità ed efficacia della didattica a distanza (DaD), chiamata anche didattica online o e-learning.[1] In particolare, nell’ambito universitario italiano tale contesto emergenziale ha portato al (sebbene parziale) superamento di un certo pregiudizio nei confronti dell’e-learning e all’integrazione a pieno regime e su ampia scala di quest’ultimo nell’ordinamento degli atenei convenzionali, nei processi tanto didattici, quanto valutativi. La sfida raccolta in questi ultimi mesi da migliaia di docenti mostra che la DaD non solo costituisce una valida risorsa – idea che da un ventennio a questa parte la letteratura scientifica internazionale dedicata alla cosiddetta distance education tenta di veicolare – ma rappresenta l’unica alternativa in grado di garantire la continuità del processo di insegnamento/apprendimento in quei casi in cui gli studenti sono impossibilitati a frequentare le lezioni in aula. Tale impossibilità può essere dettata da una condizione temporanea globale, come ad esempio l’emergenza sanitaria di Covid-19, individuale, una malattia prolungata, o da una condizione permanente che impedisce la libera mobilità e l’accesso fisico alle strutture universitarie, come nel caso di studenti residenti all’estero o portatori di disabilità. In questo senso è cruciale sottolineare «il valore dell’e-learning come modalità formativa che può contribuire all’integrazione e all’inclusione degli studenti con disabilità, grazie alle sue caratteristiche: superamento di ostacoli e vincoli spazio-temporali, possibilità di progettare percorsi flessibili, personalizzazione, interattività» [Guglielman 2011: 169]. Il presupposto di base su cui si fonda il nostro progetto risiede nella convinzione che un corso online che rispetti i requisiti dell’accessibilità sia in grado di giovare a tutte le categorie di apprendenti, ovvero, in una parola, di essere inclusivo in senso proprio.

L’obiettivo del progetto di ricerca “Per una didattica accessibile e inclusiva della lingua russa. Uno studio sperimentale” è quello di definire e verificare l’efficacia di un modello di corso accessibile di lingua russa erogato in modalità interamente e-learning, con particolare riferimento a studenti con disabilità visive. Il progetto comprende un esperimento didattico che implica la somministrazione parallela di due corsi, equivalenti per struttura, contenuti ed impegno orario, a due gruppi di apprendenti: il Gruppo 1, che fungerà da gruppo di controllo (GC), e il Gruppo 2, che costituirà il gruppo sperimentale (GS). Gli apprendenti del GS, a differenza di quelli del GC, potranno fruire di materiali accessibili anche a persone ipovedenti e non vedenti, in termini tanto informatici, quanto didattici.

Per ciascun gruppo il corso consisterà di 36 ore complessive, di cui 18 ore di didattica erogata in modalità sincrona e asincrona, e 18 ore di attività online svolte autonomamente dagli apprendenti. La durata del corso sarà di 6 settimane. Ciascuna settimana prevederà 3 ore di didattica con il docente e 3 ore di lavoro autonomo. Le ore di didattica verranno erogate nelle seguenti modalità: 2 ore e 30 minuti in modalità sincrona e 30 minuti in modalità asincrona. La didattica in modalità sincrona consisterà di due incontri settimanali fissi, ciascuno della durata di 1 ora e 15 minuti. La didattica in modalità asincrona sarà costituita da più video registrati dal docente per una durata totale di 30 minuti. Il lavoro autonomo comprenderà compiti e attività variegati che ciascun apprendente sarà chiamato a svolgere senza la presenza del docente.

La didattica in modalità sincrona e asincrona sarà svolta da uno stesso docente di L1 italiana e la lingua di erogazione sarà l’italiano alternato al russo; qualora i compiti destinati al lavoro autonomo prevederanno attività di ascolto, i materiali saranno registrati da un docente di L1 russa.

La piattaforma principale destinata ad accogliere e gestire il nostro corso online sarà Moodle. Verrà creata una pagina ad hoc per ciascuno dei due gruppi di apprendenti che conterrà: (a) i materiali didattici creati ex novo; (b) il link agli incontri settimanali con il docente, che si svolgeranno sulla piattaforma Zoom; (c) il rimando ai video registrati dal docente con l’ausilio della piattaforma Panopto; (c) le attività di apprendimento e produzione, i compiti e gli esercizi che gli apprendenti dovranno svolgere in autonomia. Inoltre, ciascuna pagina Moodle consentirà di gestire eventuali comunicazioni tra docente e apprendenti, nonché favorire l’interazione all’interno dello stesso gruppo di apprendenti.

Al termine di ciascun corso ci si aspetta che gli studenti abbiano acquisito le competenze di base della lingua russa; in particolare saranno in grado di:

  1. presentare se stessi e gli altri; fare conoscenza;
  2. dare informazioni di base su di sé e gli altri;
  3. fare domande e rispondere su particolari personali come: dove si abita, in che mese si è nati, le persone che si conoscono, la propria età, le cose che si possiedono, cosa si fa nel tempo libero, cosa si ama mangiare, dove si sta andando, cosa si è fatto ieri;
  4. chiedere dove è possibile comprare/trovare qualcosa;
  5. salutare, ringraziare e interagire in modo semplice, purché l’altra persona parli lentamente e chiaramente e sia disposta a collaborare.

Di seguito presentiamo il piano didattico, con scansione settimanale, che verrà attuato in entrambi i corsi online.

 

 

Lessico

Strutture morfo-sintattiche

Settimana 1

Как тебя зовут? Меня зовут…

Как дела? Хорошо / Плохо / Cупер / Нормально

Добрый день! / До свидания!

Кто это? / Что это?

Это мама, папа, студент, студентка, журналист, инженер, доктор…

Это компьютер, журнал, университет, газета, фотография, лампа, водка…

Это…? Да / Нет.

 
  • Pronomi interrogativi кто / что
  • Pronome soggetto это
  • Verbo essere al presente
  • Domande, risposte affermative / negative;
  • Pronomi personali al nominativo, I e II pers. sing. all’accusativo
  • L’alfabeto [si insegnerà agli apprendenti a scrivere con la tastiera cirillica]

 

Settimana 2

Ты итальянец / итальянка?

(Он) актёр, автобус, спорт…

(Она) актриса, музыка, машина…

(Оно) вино, метро, кино…

– Как по-русски…? – Я не знаю.

Моя мама, сестра, бабушка…

Мой папа, брат, дедушка…

 
  • Il genere dei sostantivi
  • Negazione
  • Aggettivi possessivi (мой, моя; твой, твоя; его, её);

 

Settimana 3

У тебя есть…? Да, у меня есть…

[банан, лимон, билет, паспорт, гитара, книга, вода…]

Я итальянец. Я живу в Италии. Я живу в Вероне.

[по телефону] – Алло! Где ты? – Я дома / здесь / в университете…

Месяцы и времена года: декабрь, январь, февраль (зима), март, апрель, май (весна), июнь, июль, август (лето), сентябрь, октябрь, ноябрь (осень)

Когда ты родился / родилась? В августе / … / Зимой / …

В Италии летом тепло. / В России зимой холодно. В Москве / В Петербурге…

Где ты был / была летом?

 
  • Costruzione per esprimere il possesso
  • Complemento di stato in luogo (Где?): avverbi di stato in luogo, в + prep.
  • Complemento di tempo (Когда?): в + prep. (con i mesi)
  • Il plurale dei sostantivi
  • Il passato di быть
 

Settimana 4

Завтрак, обед, ужин

Части сутки: утро, день, вечер (утром, днём, вечером)

Продукты и блюда: – Что ты любишь есть на завтрак / … ? – Я люблю есть фрукты, круассан, …

На ужин я люблю есть рис, макароны, …, пиццу, рыбу

– Что ты любишь пить на завтрак?

Хобби и свободное время: – Что ты любишь делать в свободное время? – Я люблю читать (книги) / смотреть (фильмы) / ходить в театр / …

 
  • Il verbo любить all’infinito e alla I pers. sing.
  • I verbi есть/пить, читать, отдыхать, спать, смотреть, встречать, говорить, ходить ecc. all’infinito

 

Settimana 5

– Где можно читать книги?

Числа до 100

– Который час сейчас? – Cейчас час / 2 часа / 5 часов

– Сколько тебе лет? – Мне …

– Что ты делаешь утром? – Я работаю / …

– Что обычно делает мама утром? – Она обычно …

– Что делаю мама и папа / друзья … вечером? – Они…

 
  • Il predicativo можно
  • Verbi di I coniugazione al presente
  • Coniugazione di писать
  • Verbi di II coniugazione al presente
 

Settimana 6

– Что ты делал вчера? – Вчера я смотрел футбол / встречал друзей / …

– Куда ты идёшь/едешь? – В магазин / в университет / на стадион… / в библиотеку / на почту

– Куда ты ходил/ездил вчера?

 
  • Il passato dei verbi
  • Verbi идти / ехать al presente
  • Complemento di moto a luogo (Куда?): в/на + асс.
  • Ходить / ездить al passato
 

 

Al termine del corso gli apprendenti del GS e del GC saranno sottoposti a due test che verranno somministrati, il primo, entro la settimana successiva alla conclusione del corso (post-test), il secondo, a distanza di un mese (delayed post-test) dalla conclusione del corso. Per i dettagli relativi alla tipologia, alle modalità di somministrazione ed alle finalità dei test che verranno realizzati si rimanda al contributo “Verso una didattica accessibile del russo LS: testare le competenze linguistiche di studenti non vedenti”.

 

Bibliografia di riferimento

Aslantaş, Tuğba Kamalı (2017). «Foreign language education of visually impaired individuals: A review of pervasive studies». Ihlara Eğitim Araştırmaları Dergisi, 2(2), 95-104.

Berbery, Tammy; Hamilton, Elizabeth C.; Sutherland, Ian M. (eds.) (2008). Worlds Apart: Disability and Foreign Language Learning. New Haven, CT: Yale University Press.

Daloiso, Michele (2014). Lingue straniere e disturbi specifici dell'apprendimento. Un quadro di riferimento per la progettazione di materiali glottodidattici accessibili. Torino: Loescher.

Esposito, Giuseppe; Mantese, Giuseppe (2003). E-Learning: una guida operativa. Come realizzare e valutare un progetto. Milano: Franco Angeli.

Formiconi, Andreas R. (2016). «La tortuosa via della didattica online all’università». Studi sulla formazione, 1, 105-132.

Formiconi, Andreas R., et al. (2017). «E-learning all’università. Indagine esplorativa sulla didattica online nell’ateneo fiorentino». Design the Future, 91-102.

Guglielman, Eleonora (2011). «Verso l’“e-learning” inclusivo. Primi contributi per la costruzione di linee guida per l’accessibilità metodologico-didattica». Journal of Educational, Cultural and Psychological Studies (ECPS Journal), 2(4), 167-186.

Macagno, Claudio G. (2017). «Risorse online per la didattica del russo (A1 e A2). Nuove tecnologie, nuove opportunità». Nuova Secondaria, XXXIV (7), 91-94.

Moore, Michael G; Kearsley, Greg (2011). Distance education: A systems view of online learning. Belmont, CA: Cengage Learning.

Mulloy, Austin M., et al. (2014). «Assistive technology for students with visual impairments and blindness». Lancioni, Giulio E.; Singh, Nirbhay N. (eds.), Assistive Technologies for People with Diverse Abilities. NY: Springer, 113-156.

Trentin, Guglielmo (2006). «Dall’e-learing formale a quello informale attraverso i processi di gestione e condivisione della conoscenza professionale». TD – Tecnologie didattiche, (3), 39-40.

Trentin, Guglielmo (2020). Didattica con e nella rete. Dall’emergenza all’uso ordinario. Milano: Franco Angeli.

Trinchero, Roberto (2006). Valutare l’apprendimento nell’e-learning. Dalle abilità alle competenze. Trento: Erikson.

Vu, P.; Fredrickson, S.; Moore, C. (eds.) (2017). Handbook of Research on Innovative Pedagogies and Technologies for Online Learning in Higher Education. Hershey, PA: IGI Global.


[1] Con queste denominazioni intendiamo in termini generali «una modalità d’uso delle tecnologie informatiche e della comunicazione a supporto dei processi di insegnamento/apprendimento basati sull’erogazione elettronica di contenuti, sull’apprendimento attivo e/o collaborativo» [Trentin 2006: 39].

 

Daniele Artoni, Jacopo Saturno, Rimma Urkhanova - Verso una didattica accessibile del russo LS: testare le competenze linguistiche di studenti non vedenti

Il presente contributo ha l’obiettivo di illustrare e discutere le modalità di testing ideate per verificare il grado di apprendimento delle competenze linguistiche di studenti principianti di russo LS. In particolare, i task presentati hanno la caratteristica di essere completamente accessibili anche ad apprendenti non vedenti e ipovedenti. Questo requisito è legato alla natura dell’esperimento didattico per il quale sono stati ideati i test, ovvero i corsi organizzati nell’ambito del progetto di ricerca “Per una didattica accessibile e inclusiva della lingua russa. Uno studio sperimentale”.

Come illustrato nella comunicazione di Boschiero, Pomarolli e Ruvoletto, l’esperimento didattico consiste nella somministrazione di un corso di lingua russa per principianti assoluti di 36 ore interamente online – in modalità sincrona e asincrona – a due gruppi, uno dei quali con studenti non vedenti e ipovedenti. Al fine di verificare il grado di apprendimento, si è deciso di somministrare – sempre in modalità online sincrona tramite piattaforma Zoom – un test composto da tre task in tre fasi diverse dell’esperimento, ovvero (i) un pre-test prima dell’inizio del corso, (ii) un post-testimmediatamente dopo la fine delle lezioni e (iii) un delayed post-test cinque settimane dopo la conclusione delle attività didattiche.

Per quanto riguarda lo svolgimento dei test, la selezione è ricaduta su quei task che potessero essere somministrabili anche online e che fossero accessibili a informanti non vedenti. Basandosi sull’esperienza di testing sviluppata per lo studio degli stadi d’apprendimento iniziali all’interno del Progetto VILLA (Dimroth et al. 2013), sono stati individuati e resi accessibili i seguenti task: (a) phoneme discrimination, per indagare la capacità di identificare alcuni fonemi della lingua russa; (b) word recognition, per verificare lo sviluppo delle competenze lessicali; (c) sentence imitation, per comprendere lo sviluppo delle competenze grammaticali.

Il test (a) phoneme discrimination prevede l’ascolto di una coppia di stimoli monosillabici identici o differenti per un solo tratto (es. /ba/ /pa/); immediatamente dopo aver sentito ciascuna coppia di stimoli, l’apprendente deve indicare se gli stimoli sono identici o diversi (Dimroth et al. 2013, Shoemaker 2016). Le strutture target dell’esperimento sono: sonorità, palatalizzazione, la discriminazione tra /i/ e /i/ e tra /ʂ/ е /ɕ/.

Il test (b) word recognition prevede l’ascolto di un enunciato in russo, a cui segue l’ascolto di una parola isolata; l’apprendente deve indicare se la parola era presente o meno nella frase (Shoemaker & Rast 2013). Il lessico target del test include parole frequenti e non frequenti (es. čelovek vs pokolenie), trasparenti e non-trasparenti (es. frukty vs maslo).

Il test (c) sentence imitation, il test di ripetizione (Spada, Shiu & Tomita 2015), richiede ai partecipanti di ascoltare una frase stimolo e ripeterla nel modo più accurato possibile, tipicamente dopo aver svolto una semplice attività volta a inibire la memoria fonologica. Quest’ultima si riferisce alla capacità innata di memorizzare per un breve periodo di tempo una sequenza di suoni, indipendentemente dal suo significato. Tale periodo di tempo può essere inoltre prolungato ripetendo mentalmente la sequenza di suoni (Baddeley, Gathercole & Papagno 1998). Dal momento che il test di ripetizione si propone di accedere alla competenza grammaticale implicita del partecipante, chiaramente è essenziale evitare che la ripetizione si possa avvalere di questo meccanismo. A questo scopo si possono utilizzare una varietà di semplici esercizi, a condizione che essi prevedano la verbalizzazione di una sequenza di suoni che vada a sostituirsi alla frase bersaglio nella memoria fonologica dei partecipanti (es. la verbalizzazione di un calcolo complesso). A queste condizioni, la logica del test di ripetizione è la seguente: laddove il ricordo della forma (es. terminazioni di caso in quanto segmenti fonologici) della frase bersaglio svanisce rapidamente, il suo significato, una volta identificato, permane più a lungo e può essere nuovamente espresso. Ciò implica che tanto la comprensione della frase bersaglio, quanto la sua riformulazione dipendono dalla competenza attuale del partecipante, il quale sarà in grado di comprendere e – soprattutto – riformulare soltanto quelle strutture che fanno già parte della sua competenza. Viceversa, le strutture che la sopravanzano saranno omesse oppure distorte rispetto alla varietà bersaglio.

Grazie alla sua flessibilità, il test di ripetizione è stato applicato a numerosi ambiti di studio, quali l’acquisizione di L1 (Håkansson 1989) e L2 (Schimke 2011; Saturno 2019) e i disturbi specifici del linguaggio (Marinis & Armon-Lotem 2015). Tra i principali vantaggi ai fini del progetto si possono annoverare il pieno controllo sulla struttura bersaglio e la relativa rapidità di somministrazione e valutazione (Van Moere 2012). Trattandosi di un test intrinsecamente orale, è evidente l’appropriatezza per la popolazione dei non vedenti. Infine, il test offre la possibilità di osservare direttamente la produzione orale dell’apprendente, consentendo così analisi di tipo sia quantitativo, sia qualitativo.

Le principali critiche al test di ripetizione riguardano il coinvolgimento della memoria fonologica (si veda Vinther 2002 per una rassegna) e il fatto che il suo meccanismo non rispetti la produzione di L2 (Pienemann 2015). Per quanto riguarda le varietà iniziali di apprendimento considerate nel progetto, inoltre, potrebbe porsi il problema di distinguere tra produzione di strutture formulaiche e acquisizione di strutture grammaticali produttive, in quanto le primissime fasi di acquisizione sono in generale caratterizzate dalla prevalenza di strutture formulaiche inanalizzate (Artoni & Magnani 2015).

 

Artoni, Daniele & Marco Magnani. 2015. Acquiring case marking in Russian as a second language: an exploratory study on subject and object. In Camilla Bettoni & Bruno Di Biase (eds.), Grammatical development in second languages: Exploring the boundaries of Processability Theory, 177–193. Amsterdam: EuroSLA.

Baddeley, Alan, Susan Gathercole & Costanza Papagno. 1998. The Phonological Loop as a Language Learning Device. Psychological review 105(1). 158–173.

Dimroth, Christine, Rebekah Rast, Marianne Starren & Marzena Watorek. 2013. Methods for studying the acquisition of a new language under controlled nput conditions. The VILLA project. In EUROSLA Yearbook 13, 109-138. Amsterdam: John Benjamins.

Håkansson, Gisela. 1989. The Acquisition of Negative Placement in Swedish. Studia Linguistica 43(1). 47–58.

Marinis, Theodoros & Sharon Armon-Lotem. 2015. Sentence Repetition. In Sharon Armon-Lotem, Jan de Jong & Natalia Meir (eds.), Assessing multilingual children disentangling bilingualism from language impairment, 95–122. Bristol ; Buffalo: Multilingual Matters.

Pienemann, Manfred. 2015. An Outline of Processability Theory and Its Relationship to Other Approaches to SLA. Language Learning

65(1). 123–151. doi.org/10.1111/lang.12095.

Saturno, Jacopo. 2019. Elicited imitation as a diagnostic tool of morphosyntactic processing. In Ragnar Arntzen, Gisela Håkansson, Arnstein Hjelde & Jörg-U. Keßler (eds.), Teachability and Learnability across languages, 119–136. Amsterdam: John Benjamins.

Schimke, Sarah. 2011. Variable verb placement in second-language German and French: Evidence from production and elicited imitation of finite and nonfinite negated sentences. Applied Psycholinguistics 32(04). 635–685.

Shoemaker, Elleanor. 2014. The development of perceptual sensitivity to Polish sybilants at first exposure. Proceeding of AMP 2014. 1–10.

Shoemaker, Elleanor & Rebekah Rast. 2016. Extracting words from the speech stream at first exposure. Second Language Research 29(2). 165–183.

Spada, Nina, Julie Li-Ju Shiu & Yasuyo Tomita. 2015. Validating an Elicited Imitation Task as a Measure of Implicit Knowledge: Comparisons With Other Validation Studies. Language Learning 65(3). 723–751.

Van Moere, Alistair. 2012. A psycholinguistic approach to oral language assessment. Language Testing 29(3). 325–344.

Vinther, Thora. 2002. Elicited imitation: a brief overview. International Journal of Applied Linguistics 12(1). 54–73.

 

Tatiana A. Ostakhova - Agentivi femminili in ucraino: tradizione o innovazione?

A distanza di un anno dalla standardizzazione della formazione degli agentivi femminili nell’ultima redazione di Ukrajins’kyj pravopys (UP 2019) si registrano i primi segni della loro codificazione nei documenti normativi. Ne è testimonianza l’elaborazione di una bozza delle Modifiche № 9 al Classificatore delle professioni (NKU 2019) che prevede di regolarizzare l’uso degli agentivi femminili derivati da basi maschili e il cui paragrafo 22 della sezione 3 “Disposizioni di base” specifica in particolare che all’atto della registrazione del titolo professionale nella documentazione di lavoro di un singolo dipendente, sulla richiesta di quest’ultimo, i titoli professionali possono essere adattati per identificare il genere femminile della persona che esegue i determinati lavori (conformemente al punto 4 del paragrafo 32 dell’Ortografia ucraina approvata dal Consiglio dei Ministri del 22.05.2019 № 437).

In tal  modo la disputa sull’accettabilità e l’opportunità dell’uso degli agentivi femminili si delinea non solo a loro favore, ma anche a conferma della tesi che il sistema derivativo nominale è in grado di assolvere alla necessità di denominare una donna. Nel dibattito linguistico ucraino si asserisce che la formazione dei feminityvy testimonia un’antica tradizione linguistica, rappresenta un fenomeno naturale e intrinseco all’ucraino, attestato già nel periodo della politica bolscevica di ukrajinizacija degli anni 1920-30 e ostacolato in epoca sovietica dall’imposizione artificiale del modello compositivo del tipo žinka-likar (donna medico) e dalla limitazione dell’uso dei correlati femminili già esistenti come likarka (dottoressa), contrassegnati dalla marcatura stilistica colloquiale e confinati nei dialetti (Brus 2006, 2001, 2009; Moroz 2009; Neljuba 2011; Puzyrenko 2005). Un punto di vista diverso lo riscontriamo in Archanhel’s’ka (2014), la cui l’indagine sulla ricorrenza degli agentivi femminili nelle fonti lessicografiche a cavallo tra il XIX e XX secoli e negli anni 1920-30 non conferma l’intensità della mozione e la sua regolarità in quanto fenomeno rappresentativo per la lingua ucraina nel periodo preso in esame. Gli studi di Poda (2009, 2010, 2011) condotti sui titoli delle riviste degli anni 20-40 del XX secolo rivelano l’asimmetria di genere in riferimento alle categorie professionali e una tendenza all’uso degli agentivi femminili ritenuti “importanti e socialmente utili” per l’ideologia socialista come kolhospnycja, komunarka, seljanka, robitnycja. Non sono stati condotti gli studi sull’uso degli agentivi femminile nella stampa periodica, lacuna che la nostra ricerca empirica sui periodici ucraini della prima metà del XX secolo mira a colmare. Lo scopo è quello di rilevare i valori quantitativi e la variabilità a livello diacronico e diatopico per il convenience sample costituito da 12 agentivi femminili con il formante –k(a) derivati da diverse basi maschili e denotanti status sociale (seljanka, herojka/heroijnja), appartenenza politica (tovaryška, deputatka), incarichi (dyrektorka/dyrektrysa/dyrektorša), professioni (avtorka; likarka; korespondentka; poetka/poetesa), titoli accademici (profesorka/profesorša) e per i rispettivi composti con determinante a sinistra (žinka-dyrektorka, pani dyrektorka, panіprofesor) ove presenti. Nella scelta si è optato per i nomi d’agente più rappresentativi per il periodo storico preso in esame come professioni/incarichi che potenzialmente potevano essere esercitate/ricoperte dalle donne nel primo ventennio del XX secolo e quelle nuove, apparse successivamente in seguito alla politica di coinvolgimento della donna nella vita sociale e lavorativa dello stato sovietico.

Come fonte della ricerca empirica è stato utilizzato l’archivio della stampa periodica ucraina Libraria (https://libraria.ua/), progetto della società Archivni informacijni systemy (Sistemi informatici d’archivio) realizzato a partire dal 2012 in collaborazione con biblioteche, archivi e istituzioni scientifiche in Ucraina e all'estero. L’archivio fornisce accesso online ai periodici storici ucraini pubblicati in diverse regioni dell'Ucraina e all'estero dall’inizio del XX secolo fino agli anni Cinquanta.

Un grande vantaggio del corpus è la possibilità di eseguire ricerche su una vasta quantità di materiale. Si possono consultare in formato digitale circa 700.000 pagine di oltre 400 pubblicazioni in ucraino, russo, polacco, tedesco, rumeno, yiddish e tataro di Crimea. La possibilità offerta dalla consultazione del formato digitale permette di verificare l’accordo delle entrate con il predicato verbale/nominale o i determinanti in un ampio contesto.

Nonostante il corpus sia annotato morfologicamente, il riconoscimento dei lemmi spesso avviene con un largo margine di errore, ciò richiede uno spoglio in regime manuale. Un altro svantaggio è rappresentato dalla discontinuità cronologica dei periodici, per cui i dati si riferiscono solo ad alcune annate delle testate. Tuttavia l’opportunità offerta dalla consultazione online rende Libraria una preziosissima fonte di ricerca a livello diacronico. In riferimento al nostro convenience sample sono state rilevate più di 4000 occorrenze.

Per la praticità della ricerca viene proposta la seguente suddivisione  temporale del periodo preso in esame (la prima metà del XX secolo): 1900 - 1918 (inizio secolo e primi anni dopo la rivoluzionе), 1919 - 1929 (periodo post-rivoluzionario e avvio della politica di ucrainizzazione), 1930 - 1939 (russificazione) e 1940 - 1950 (periodo bellico e post-bellico).

 

Bibliografia

UP       Ukrajins’kyj pravopys

(2019). Schvaleno Kabinetom Ministriv Ukrajiny (Postanova № 437 vid 22 travnja 2019 r.). URL mon.gov.ua/storage/app/media/zagalna %20serednya /05062019-onovl-pravo.pdf (19.06.2019) 

NKU   Nacional’nyj klasifikator Ukrajiny, Klasifikator profesij DK 003:2010

(2019). Klasifikator profesij iz zminamy, zatverdženymy nakazom Ministerstva ekonomičnoho rozvytku i torhivli Ukrajiny vid 15 ljutoho 2019 roku № 259. URL hrliga.com index.php?module=norm_base&op=view&id=433 (04.06.2020)

Archanhel’s’ka, Alla M. (2014). Do problemy slovotvirnoji feminizaciji v ukrajins'kij movi novitn'oji doby: tradycija i sučasnist’. II, in «Movoznavstvo», 1, 58-70.

Bocale, Paola (2007). Profesor o profesorka? Il genere dei nomi di professione in ucraino e bulgaro, SLIFO, Dipartimento di Linguistica, Università di Pisa, 5.1., 85-128.  URL http//www.humnet.unipi.it/slifo (10.03.2020)

Brus, Marija (2001). Zahal’nižinoči osobovi nominaciji v ukrajins’kij movi XVI-XVII stolit’: slovotvir i semantyka: Dys. kand. filol. nauk,Prykarpat. un-t imeni Vasylja Stefanyka, Ivano-Frankivs’k.

Brus, Marija P. (2006). Feminityvy v ukrajins’kij movi XI-XV st., in «Visnyk Zaporiz’koho nacional’noho universytetu», Filolohični nauky, Zaporižžja, 28-34.

Brus, Marija P. (2009). Feminityvy ukrajins’koji movy v perepletenni davnich i sučasnych tendencij, in «Visnyk L’vivs’kogo universytetu», Serija Filolohija, Vyp. 46, Č. 1, L’viv, 61-69.

Moroz, Tetjana Ju. (2009). Javyšče semantyko-hramatyčnoji asymetriji v systemi morfolohičnych katehorij imennyka. Charkiv: Pravo.

Neljuba, Anatolij (2011). Žinky. Hender. Slovotvir, in «Zbirnyk Charkivs'kogo istoriko-filolohičnoho tovarystva», Nova serija, 14, Charkiv: Charkivs’ke istoryko-filolohične tovarystvo, 189-204.

Ostakhova, Tatiana A. (2019). I feminityvy della lingua ucraina, in L’Ucraina alla ricerca di un equilibrio. Sfide storiche, linguistiche e culturali da Porošenko a Zelenskij, Edizioni Ca’ Foscari EURASIATICA 14, 109-124.

Poda, Olena Ju. (2010). Žinoča storinka v hazeti jak kanal hendernoji komunikaciij vlady, in Deržava ta rehiony: nauk.-vyrob. žurn. Serija Social’ni komunikaciij, № 2, 150-154.

Poda, Olena Ju. (2009). Rol’ hendernogo faktoru u formuvanni redakcijnoij polityky žurnaliv Radjans’koij Ukraijny 20-ch rokiv XX stolittja (na prykladi «Komunarky Ukraijny», «Seljanky Ukraijny», «Červonoij presy»), Dialoh: medija-studiij, 217-229.  

Poda, Olena Ju. (2008). HazetyRadjans’koij Ukraijny 20-40 ch rokiv XX stolittja: problemy hendernoho markuvannja nazv, in

«Psicholinhvistyka», Vyp. 1. (12.06.2020): nbuv.gov.ua/UJRN/ psling_2008_1_22

Puzyrenko, Jaryna V. (2005). Ahentyvno-profesijni nazvy osibžinočoij stati v leksykohrafyčnomu opysi ta uzusi. Avtoref. dys. kand. filoloh. nauk: 10.02.15. Kyijv. nac. Un-t im. T. Ševčenka, In-t filolohiij, Kyijv.

Skopenko, Oleksandr I. (2020). Ukrajins’kyj pravopys: tradiciij i sučasnist’ (mali štrychy do velykoij istoriij), Visnyk NAN Ukraijny, № 3, 78-87.

Zemskaja, Elena A. (2010). Literaturnaja norma i neuzual’noe slovoobrazovanie, in Sovremennyj russkij jazyk. Sistema – norma – uzus. Institut russkogo jazyka im. V.V. Vinogradova RAN, Moskva: Jazyki slavjanskich kul’tur (Studia philologica), 239-242.

Žurženko, Tat’jana (2001). Social’noe vosproizvodstvo i gendernaja politika v Ukraine, Char’kov.

 

Valentina Benigni - Sumasšestvie kakoe-to! Da indefinito epistemico ad intensificatore: il caso di kakoj-to

Il presente lavoro si inserisce nel ricco filone di studi sull'intensificazione, intesa come l'operazione semantico-cognitiva che permette di modulare la forza referenziale di un elemento lessicale; nello specifico verrà indagato il modo in cui il russo utilizza in funzione intensificativa l’indefinito epistemico kakoj-to. Attraverso un approccio basato sull'uso si cercherà di individuare quali:

  • schemi sintattici (o schematic idiom, Croft & Crouse 2004: 233-234) prevedono l’uso dell’indefinito epistemico;
  • quali classi di nomi sono compatibili con gli schemi individuati;
  • quali altri elementi lessicali tendono a cooccorrere con la costruzione.

I risultati dell'analisi verranno discussi secondo una prospettiva cognitivo-funzionale al fine di evidenziare i meccanismi di estensione semantica che dal dominio dell'indefinitezza conducono a quello dell'intensificazione.

L’indefinito  epistemico kakoj-to svolge funzione intensificativa-valutativa soprattutto in enunciati commentativi riconducibili allo schema:

  1. [(èto) + N + kakoj-to]
  1. Sumasšestvie kakoe-to.

È pura follia. (Opus2)

  1. Bessmyslica kakaja-to, ja ne podavala zajavku na postuplenie.

Ma non ha alcun senso... non ho mai fatto domanda. (Opus2)

A livello discorsivo, gli enunciati commentativi hanno funzione rematica, in quanto apportano un elemento valutativo rispetto ad un topic precedentemente introdotto. Nella comunicazione dialogica tendono ad aprire un turno di replica. Le versioni italiane del medesimo frammento testuale ricavate dal corpus parallelo di sottotitoli Opus2 confermano la funzione intensificativa-valutativa associata all’indefinito epistemico (cfr. (1a): pura follia, (1b): non ha alcun senso)

In questo schema l’indefinito tende a collocarsi dopo il N a cui si riferisce e tale posizione sembra associarsi maggiormente ad una lettura intensificativa-valutativa rispetto alla posizione preposta; è plausibile ipotizzare che l’indefinito abbia sviluppato tale uso secondario a partire dall’originario senso similativo-approssimativo (che Ožegov & Švedova 1949-1992 indicano come «piuttosto simile, che ricorda in parte qualcuno o qualcosa. On kakoj-to čudak.», trad. mia), spesso rinforzato da elementi del co-testo (vygljadit kak in (2)):

  1. On vygljadit kak ubijca kakoj-to.

Sembra un assassino. (Opus2)

Sia il significato approssimativo che quello intensificativo apportano un elemento di valutazione soggettiva che probabilmente è alla base del processo di deriva semantica (‘tipo / una specie di N’ à ‘un vero N’) e di pragmaticalizzazione secondaria (approssimatore à intensificatore) che qui tenteremo di ricostruire. A tale proposito può essere utile individuare in via preliminare la classe di nomi che tendono a “collocarsi” nello schema sintattico presentato. Da un primo spoglio dei dati emerge che nella costruzione tendono a confluire nomi appartenenti alla classe degli atypical noun, ovvero nomi intrinsecamente scalari “which focus on a single feature, such as hero or saint” e sono “more readily accessible to comparison and ‘measurement’” (Wierzbicka 1988: 486).

Nello specifico si tratta di nomi vaghi, usati per indicare cose, stati e situazioni (3), oppure nomi che rimandano a referenti animati (4), a cui si associa in generale una prosodia semantica negativa:

  1. bezumie ‘follia’, glupost’ ‘stupidaggine’, užas ‘incubo’
  2. žulik ‘truffatore’, pridurok ‘idiota’, psich ‘pazzo’

Più raramente nella costruzione confluiscono nomi vaghi connotati positivamente, sempre riferiti a cose, stati, situazioni (5) o persone (6):

  1. kurort ‘luogo di villeggiatura’, skazka ‘favola’
  2. supermozg‘cervellone’

Il processo di deriva semantica e di pragmaticalizzazione sembra attivarsi in contesti ponte, ovvero contesti analoghi sul piano distribuzionale in cui in base all’informazione condivisa dai parlanti è possibile associare all’indefinito epistemico una lettura similativa-approssimativa oppure intensificativa (mutʹ kakaja-to equivale a ‘una stronzata simile / del genere’ in (7) e a ‘una vera e propria stronzata’ in (8)). Le versioni italiane dei due testi sottolineano le diverse funzioni dell’indefinito:

  1. - Èto kakoe-to Otkrytoe Akcionernoe Obŝestvo.

- Kakoe?

- Ne pomnju, mutʹ kakaja-to.  On nazval zarplatu i dumal, čto ja emu budu pjatki lizatʹ.

- Un'organizzazione progressista. 

- Quale? 

- Non so. Prima Fondazione dei Damerini, o stronzate simili(Opus2)

 

  1. On chočet nogu Migelito? Mut’ kakaja-to.

Voleva il piede di Miguelito?  È da malati, amico. (Opus2)

L’interpretazione intensificativa viene rinforzata dalla presenza nel co-testo di intensificatori quali prosto ‘semplicemente’ e prjamo ‘proprio’, che entrano in conflitto con la funzione di downtoner tipica del significato similativo-approssimativo:

  1. Prostoskazkakakaja-to.

È come una favola. (Opus2)

Un altro contesto che sembra facilitare una lettura intensificativa dell’indefinito è quello che vede un aggettivo, spesso un intensificatore esso stesso, ricadere nella portata dell’indefinito (11), secondo lo schema:

  1. [(èto) + N + kakoj-to + AGG]
  2. To byl pridurok kakoj-to polnyj.

Quello era un completo idiota. (Opus2)

Nell’individuazione del processo di pragmaticalizzazione secondaria di kakoj-to si terrà conto anche dei contesti (soprattutto a polarità negativa) in cui l’indefinito veicola un atteggiamento di svalutazione da parte del parlante nei confronti del N a cui si riferisce (Ožegov & Švedova 1949-1992 definiscono tale senso come: “Non degno di rispetto, attenzione”, trad. mia), spesso alla costruzione può associarsi anche il deittico spaziale tam ‘lì’ (cfr. Bylinina 2009):

  1. [(èto) + ne + kakoj-to + (tam) + N]

Soprattutto nel dominio dell’irrealis, dove un N già caratterizzato da una prosodia semantica negativa riceve un’interpretazione [-specifica], l’uso dell’indefinito contribuisce a “banalizzare” il referente, identificandolo come un esemplare qualunque di N, analogamente al costrutto italiano con l’indefinito di free choice  [un N qualunque/qualsiasi]:

  1. On ne byl kakim-to banditom, gotovym na vse, čtoby zaključitʹ sdelku i polučitʹ bilet iz Kvinsa, oplačennyj pravitelʹstvom.

Non era un teppista qualsiasi che non vede l'ora di fare un accordo e ottenere così un biglietto di uscita dai Queens pagato dal Governo. (Opus2)

Al pari dell’intensificazione, anche l’operazione di “banalizzazione” si basa su processi di categorizzazioneche rimandano a classi dotate di una struttura interna radiale: entrambe le strategie permettono al parlante di “svalutare” il referente, collocandolo al centro di una categoria caratterizzata da una prosodia semantica negativa, o, viceversa, spostandolo ai suoi margini.

Ulteriore evidenza viene fornita dall'approccio contrastivo, dal momento che fenomeni analoghi di convergenza tra indefinitezza e intensificazione si osservano anche in altre lingue (cfr. l’uso in ingl. dell’indefinito epistemico some: It was some party! (Anderson 2016) oppure in it. dell’articolo indeterminativo uno: Ho una fame! vs Ho fame!; Quel libroè di un bello! vs Quel libro è bello! in diversi tipi di frase esclamativa; in tali contesti è plausibile ipotizzare che l’indeterminativo attivi una lettura tassonomica, rimandando ad un sottotipo particolarmente rappresentativo all’interno delle nozioni scalari di FAME е di BELLO. Fenomeni analoghi sono osservabili anche in altre lingue che codificano l’indefinitezza mediante il ricorso all’articolo indeterminativo (cfr. Gorishneva 2009) oppure ad indefiniti epistemici).

 

Anderson C. (2016), Kinds, epistemic indefinites, and some-exclamatives. Proceedings of Sinn Und Bedeutung, 21(1), 35-52.

Bylinina E. (2009), “Kakoj-to tam”

, abstract, iling.spb.ru/nord/materia/rusconstr2009/bylinina.pdf

Croft W., Cruse A.D. (2004). Cognitive Linguistics, Cambridge University Press, Cambridge.

Gorishneva E. (2009). ‘One’: Between numeral, indefinite marker and intensifier. In: Saxena A., Viberg Å. (a cura di). Multilingualism. Proceedings of the 23th Scandinavian Conference of Linguistics. Acta Universitatis Upsaliensis 8, Uppsala Universitet. Uppsala, 37-50.

Ožegov S.I., Švedova N.Ju. (a cura di) (1949-1992), Tolkovyj slovar’ russkogo jazyka, Az’’, Moskva.

Wierzbicka A. (1988). What’s in a noun? (or: how do nouns differ in meaning from adjectives?). In: Wierzbicka A., The Semantics of Grammar, John Benjamins, Amsterdam & Philadelphia, 463-497.

 

Marco Biasio - Tradizione o corruzione? Non attualità, l’aoristo greco e la vexata quaestio del presente perfettivo nei performativi slavi

Scopo del presente intervento è apportare degli argomenti di carattere storico a favore della tesi che sostiene il carattere originariamente slavo comune della distribuzione del non-passato perfettivo (d’ora in avanti NPPF) in contesto performativo nelle lingue slave.

Nella letteratura funzionalista (vd. ad ex. Apresjan 1995: 199) prevale l’opinione che nelle lingue slave contemporanee la realizzazione formale prototipica della semantica performativa coincida con i grammemi di non-passato imperfettivo (d’ora in avanti NPIPF). Si vedano, a mo’ di esempio, i seguenti contesti dal russo (1), dal serbo-croato (2) e dal ceco (3):

(1)     – Chorošaja devčonka, – skazal pro nee Vitja. – Ja za nee ručajusNPIPF. Pomožet. [NKRJa, Marina Zosimkina. Ty prosneš’sja. Kniga pervaja (2015)]

‘«È una brava ragazzina», disse di lei Vitja. «Garantisco per lei. Vi darà una mano»’

(2)       Biće to prva sednica u Domu narodne skupštine u kojem će Ustav biti proglašen. UpozoravamNPIPF sve stranke. [KSS, poli061030.txt, Politika (30.10.2006.)]

‘Questa sarà la prima seduta nell’edificio dell’Assemblea Nazionale dove verrà promulgata la Costituzione. Avviso tutti i partiti’

(3)       PřísahámNPIPF / Nedovolím volný pád.

‘Lo giuro / Non permetterò una caduta libera’

(Tereza Kerndlová – Přísahám: www.youtube.com/watch)

È tuttavia noto che una delle prime discussioni scientifiche sulle caratteristiche tempo-aspettuali dei verbi performativi, sorta già sul finire del XIX secolo, muovesse inizialmente dai dati dello sloveno, unica tra le lingue slave in cui le occorrenze di NPPF performativo, se non superiori, perlomeno pareggiano quelle di NPIPF (vd. la ricostruzione storica in Žagar, Grgič 2011). Il fenomeno viene illustrato negli esempi sotto riportati, dove a comparire in contesto performativo sono, rispettivamente, una coppia aspettuale di performativi espositivi (4), commissivi (5) e di dichiarazioni (6). La tassonomia indicata è quella proposta, per i corrispettivi atti illocutivi, in Searle 1976:

(1)           PriznavamNPIPF/PriznamNPPF, da vas ne razumem.

(mod. da Derganc 2012: 232)

‘Ammetto di non capirla’

(2)       ObljubljamNPIPF/ObljubimNPPF, da bom vse naredil.

(mod. da Derganc 2012: 232)

‘Prometto che farò tutto’

(3)       DajemNPIPF/DamNPPF ti obvezo.

‘Ti assolvo dai tuoi peccati’

Sebbene questa concorrenza tempo-aspettuale in contesto performativo presenti alcune percepibili differenze di natura semantica e pragmatica e sia limitata ad un ristretto gruppo di verbi, si tratta di una particolarità dello sloveno che non sembra replicarsi con le stesse proporzioni nelle altre lingue slave e che, per questo, è stata più volte affrontata in aspettologia, specialmente dalla prospettiva (diacronica) del contatto linguistico. Semplificando i termini del dibattito, possiamo dire che ai poli della discussione si evidenzino due posizioni contrapposte. La posizione germanista, originariamente capitanata da Miklošič (Miklošič 1852-1875), sostiene come la distribuzione di NPPF in contesto performativo, già tratto caratteristico dei Manoscritti di Frisinga (X-XI ss.), sia stata influenzata esclusivamente dal contatto linguistico con l’alto tedesco antico e, in particolar modo, sia stata favorita dal meccanismo analogico dell’isomorfismo tra predicati preverbati in alto tedesco antico (ad ex. far-sag-ēn) e in sloveno antico (ad ex. za-glagol-eti). La posizione autoctona, capitanata da Derganc (Derganc 1996), tende invece a presentare il fenomeno come interamente interno al sistema dello sloveno, con ciò negando qualsiasi influenza del contatto linguistico.

Benché, come ammette Stephen Dickey in un suo recente studio sull’evoluzione diacronica dei performativi slavi, “[…] At present, I know of no evidence that can decide this issue” (Dickey 2015: 299), vi sono delle ragioni per ritenere che NPPF performativo sia un fenomeno originariamente slavo comune, poi divenuto più o meno marginale, per varie ragioni, nelle singole lingue slave sorte dalla disgregazione dell’originaria unità linguistica. Nel presente contributo si analizzano, in particolare, cinque possibili argomenti a favore di quest’ipotesi, particolarmente interessanti perché al contempo perfettamente compatibili con la tesi del contatto linguistico.

Il primo argomento intende difendere la specificità dei Manoscritti di Frisinga, dove NPPF è predominante in contesto performativo: pur non escludendo l’ipotesi del contatto linguistico con l’antico alto tedesco, la loro antica datazione e la loro non filiazione con il sistema dello slavo ecclesiastico farebbero presupporre l’esistenza pregressa di un simile pattern in antico sloveno (un modello definito replica preservation in Dickey 2015: 280-281).

Il secondo argomento affronta le analogie formali e funzionali in contesto performativo tra l’aoristo greco (in forme quali ᾔνησα, da αἰνέω ‘approvo’, cfr. Bary 2012) e il NPPF slavo. Viene dimostrato, in particolare, che all’interfaccia sintassi-semantica entrambe le forme condividono le medesime proprietà temporali, il che spiegherebbe le analogie di utilizzo per alcune macroclassi di performativi come, ad esempio, i performativi tetici (la definizione è di Conte 1983: 103).

Il terzo argomento prende in esame l’esistenza, nelle lingue slave meridionali (ex. in serbo-croato) in cui esiste un blocco grammaticale sull’utilizzo del presente perfettivo in proposizioni principali, di certe espressioni pseudoperformative (abusive metonymic performatives per Dickey 2015: 256), legate alla sfera delle ingiurie e delle maledizioni, che sono, al contrario, regolarmente realizzate con NPPF (ex. NabijemNPPF te na kurac!, lit. ‘Ti impalo al cazzo!’). L’ipotesi suggerita è che tali espressioni, legate ad una concezione magico-imitativa della facoltà linguistica, siano particolarmente arcaiche e si siano presumibilmente sviluppate in una fase precedente alla dissoluzione dell’unità slavo comune, costituendosi oggi come relitti linguistici.

Il quarto argomento rianalizza il ruolo dei fenomeni morfologici di preverbazione e suffissazione nel processo di grammaticalizzazione dell’aspetto slavo (Maslov 2004; Wiemer, Seržant 2017). Ci si sofferma, in particolare, sulla trasformazione dei preverbi in operatori telicizzanti e sulla conseguente nascita di un “nuovo” NPIPF processuale via suffissazione a partire dal predicato preverbato, divenuto ora propriamente perfettivo e non più utilizzabile, a differenza dello slavo comune, in contesto di presente attuale. Secondo questa ricostruzione, NPPF performativo sarebbe dunque un fenomeno originariamente slavo comune.

Il quinto e ultimo argomento, infine, affronta la stessa distribuzione di NPPF in contesto performativo nelle lingue slave contemporanee, che, come già notato in alcune recenti ricerche (Vimer 2014; Gattnar, Heininger, Hörnig 2018), è significativamente più ampia rispetto a quanto si riteneva nella letteratura dei decenni precedenti.

Bibliografia selezionata

Apresjan 1995. Apresjan Ju. D., Performativy v grammatike i v slovare, in Izbrannye trudy, Tom II. Integral’noe opisanie jazyka i sistemnaja leksikografija, Moskva, Škola “Jazyki Russkoj Kul’tury”, C. 199-218.

Bary 2012. Bary C., The Ancient Greek Tragic Aorist Revisited, in Glotta, 88, pp. 31-53.

Conte 1983. Conte M-E., La pragmatica linguistica, in Segre C. (intr., a cura di), Intorno alla linguistica, Milano, Feltrinelli, pp. 94-128.

Derganc 1996. Derganc A., Iaz ze zaglagolo Zlodeiu (K vprasanju glagolskega vida v performativnih izjavah v slovanskih jezikih), in Kosa, J. et al. (ur.), Zbornik Brižinski spomeniki, Ljubljana, Znanstvenoraziskovalni center SAZU-Institut za slovensko literaturo in literarne vede, C. 185-193.

Dickey 2015. Dickey, S. M., The Aspectual Development of Performatives in Slavic, in Zeitschrift für Slavische Philologie, 71(2), pp. 249-304.

Gattnar, Heininger, Hörnig 2018. Gattnar A., Heininger J., Hörnig R., The Russian Perfective Present in Performative Utterance, in Lenertová D., Meyer R., Šimík R., Szucsich L., Advances in Slavic Formal Linguistics 2016, Berlin, Language Science Press, pp. 127-146.

Maslov 2004. Maslov Ju. S., Roltaknazyvaemojperfektivaciiiimperfektivaciivprocessevozniknovenijaslavjanskogoglagolnogovida, in Bondarko A. V., Majsak T. A., Plungjan V. A. (pod red.), Izbrannye trudy. Aspektologija. Obščee jazykoznanie, Moskva, Jazyki slavjanskoj kul’tury, С. 445-476.

Miklošič 1852-1875.                  Miklošič F., Vergleichende Grammatik der slavischen sprachen, Wien, W. Braumüller.

Searle 1976. Searle, J., A Classification of Illocutionary Acts

, in Language in Society, 5(1), pp. 1-23. DOI: doi.org/10.1017/S0047404500006837.

Vimer 2014. Vimer B., Upotrebleniesoveršennogovidavperformativnomnastojaščem, in Kazanskij N. N. (pod red.), Acta Linguistica Petropolitana. Trudy Instituta Lingvističeskich Issledovanij: Tipologičeskie issledovanija (Posvjaščaetsja 80-letiju Viktora Samuiloviča Chrakovskogo), 10(3), Sankt-Petersburg, Nauka, C. 90-113.

Wiemer, Seržant 2017. Wiemer B., Seržant I., Diachrony and Typology of Slavic Aspect: What Does Morphology Tell Us?

, in Bisang W., Malchukov A. (ed. by), Unity and Diversity in Grammaticalization Scenarios, Berlin, Language Science Press, pp. 239-307. DOI: doi.org/10.5281/zenodo.823246.

Žagar, Grgič 2011. Žagar I. Ž., Grgič M., How to Do Things with Tense and Aspect: Performativity before Austin, Cambridge, Cambridge Scholars Publishing.

 

 Federica Floridi - Combinatoria lessicale e mutamento diacronico: un’analisi corpus-based dell’evoluzione del verbo russo činit’ 

Nella presente ricerca si affronta il problema della combinatoria lessicale, vale a dire la possibilità di una parola di co-occorrere con altre parole. In generale, accanto ad unità lessicali dotate di un ampio spettro combinatorio, in grado di associarsi liberamente ad altre unità, si possono incontrare parole caratterizzate da un raggio di combinabilità ristretto, limitato a una o poche altre unità lessicali (Konecny 2018; Ježek 2005). In quanto strettamente legata all’uso, la collocabilità di un lessema può variare in diacronia, innescando mutamenti nella struttura semantica dello stesso (Dobrovol’skij 2005:82). Questi slittamenti sintattico-lessicali, talvolta impercettibili, sono divenuti oggetto di studio di un particolare indirizzo di ricerca della russistica, che si propone di individuare le microevoluzioni linguistiche, definite “malye diachroničeskie sdvigi”, attuatesi nella grammatica e nel lessico della lingua russa fra XIX e XX secolo, a causa delle quali l’uso linguistico contemporaneo si è differenziato dall’uso passato (Dobrovol’skij 2001, 2013; Zaliznjak 2012; Padučeva 2018). 

Proiettandosi su tale sfondo teorico, il lavoro qui proposto vuole gettare luce su siffatti slittamenti, tramite un caso di studio, ossia l’analisi della collocabilità del verbo russo činit’ nell’arco di tempo compreso fra il XVIII e il XX secolo. La ricerca è condotta secondo un approccio corpus-based: a partire dalle occorrenze estratte dal Nacional’nyj Korpus Russkogo Jazyka, si esaminano i contesti in cui činit’ co-occorre con un nome oggetto diretto al caso accusativo, quindi in costruzioni V+Nogg. 

Dall’analisi emerge che il verbo indagato subisce un processo di specializzazione semantica in concomitanza con la rimodulazione del suo potenziale combinatorio. Nei testi risalenti al XVIII secolo činit’ manifesta una semantica ampia, ricoprendo le accezioni di delat’, soveršat’, ustraivat’, okazyvat’, pričinjat’; esso occorre in funzione di supporto a diversi Nogg non concreti, portatori del contenuto lessicale della costruzione: nakazanie, napadenie, nabeg, opyty, nabljudenija, dogovor, rešenie, prisjaga, prepjatstvie, pomešatel’stvo, soprotivlenie, vred, obida, utesnenie, razorenie, vspomoženie, predugotovlenie, pomošč’, propusk ecc. 

Nel corso dell’Ottocento il suo raggio collocazionale gradualmente si restringe e, nei contesti sintagmatici con Nogg non concreti, esso viene sostituito da altri verbi, come delat’, stavit’, okazyvat’, prinimat’. D’altro canto, parallelamente divengono sempre più frequenti i suoi usi con Nogg, concreti, come most, dom, doroga, časy, odežda, plat’e, bel’e, sapogi, obuv’, telega, kareta ecc., in combinazione con i quali si viene a consolidare il suo significato attuale di ‘ispravljat’, delat’ vnov’ prigodnym’. In questo modo, durante il XIX secolo činit’ si diffonde in contesti stilisticamente neutri, assumendo la medesima funzione del verbo, più colloquiale, počinjat’. Viceversa, nei testi del Settecento e della prima metà dell’Ottocento, il significato di ‘ispravljat’, delat’ vnov’ prigodnym’ viene veicolato, oltre che dal già citato počinjat’, dalla forma počinivat’, come testimoniato dagli esempi estraibili dal corpus. 

Nel russo contemporaneo si conservano alcune tracce dell’uso passato: il verbo činit’ continua ad essere utilizzato nella sua accezione originaria in un numero circoscritto di collocazioni, tipiche del registro ufficiale, co-occorrendo con Nogg non concreti, semanticamente marcati, come prepjatstvija, prepony, proizvol, nasilie, sud, rasprava, pritesnenija, nel significato di ‘soveršat’, delat’, ustraivat’ čto-n. neblagoprijatnoe’. 

Bibliografia scelta 

APRESJAN JU. D., O semantičeskoj nepustote i motivirovannosti glagol’nych leksičeskich funkcii, Voprosy Jazykoznanija, N° 4, 2004, 3 – 18. 

BAZAROV E. E., O glagol’no-imennych konstrukcijach s poluznamenatel’nym glagolom v delovych dokumentach zabajkal’ja konca XVII v., Russkij jazyk v naučnom osveščenii, N° 1 (35), 2018, 207 – 225. 

DOBROVOL’SKIJ D. O., K dinamike uzusa (jazyk Puškina i sovremennoe slovoupotreblenie), Russkij jazyk v naučnom osveščenii, N° 1, 2001, 161 – 178. 

DOBROVOL’SKIJ D. O., Faktory sočetaemosti: semantika, pragmatika, uzus, Russkij jazyk v naučnom osveščenii, N° 2 (10), 2005, 43 – 86. 

DOBROVOL’SKIJ D. O., Leksičeskaja semantika v diachronii: jazyk chudožestvennoj prozy Puškina i sovremennoe slovoupotreblenie, Avtorskaja leksikografia i istorija slov: K 50-letiju vychoda v svet “Slovarja jazyka Puškina”, Izdatel’skij centr “Azbukovnik”

, 2013, www.researchgate.net/publication/283328568_Leksiceskaa_semantika_v_diahronii_azyk_hudozestvennoj_prozy_Puskina_i_sovremennoe_slovoupotreblenie (ultimo accesso 13/07/2020). 

JEŽEK E., Lessico: classi di parole, strutture, combinazioni, Il Mulino, Bologna, 2005. 

KONECNY K., La monocollocabilità: un fenomeno di interfaccia tra sincronia e diacronia, Phrasis. Rivista di studi fraseologici e paremiologici, N° 2, 2018, 60 – 76. 

LAGUZOVA E. N., Opisatel’nyj glagol’no-imennoj oborot kak edinica nominacii, Avtoreferat dissertacii, Moskva, 2003. 

PADUČEVA E. V., Russkij liternaturnyj jazyk do i posle Puškina, in Gerhard Ressel, A. S. Puškin und die kulturelle Identität Rußlands, Peter Lang, Frankfurt am Main, 2001, 97 – 108. 

PADUČEVA E. V., Iz nabljudenij nad jazykom L. Tolstogo (k voprosu o malych diachroničeskich sdvigach), Voprosy Jazykoznanija, N° 5, 2018, 49 – 63. 

PLUNGJAN V. A., Korpus kak instrument i kak ideologija: o nekotorych urokach sovremennoj korpusnoj lingvistiki, Russkij jazyk v naučnom osveščenii, N° 2 (16), 2008, 7 – 20. 

TIMOCHINA E., Istorija razvitija glagola “kanut’” XIX-XX veka

(NKRJa) studiorum-ruscorpora.ru/meanings/presentations/ (ultimo accesso 13/07/2020). 

VINOGRADOV V. V., Ob osnovnych tipach frazeologičeskich edinic v russkom jazyke, in Vinogradov V. V., Izbrannye trudy. Leksikologija i leksikografija, Nauka, Moskva, 1977, 140 – 161. 

VINOGRADOV V. V., Očerki po istorii russkogo literaturnogo jazyka XVII-XIX vekov, Izd-vo Vysšaja Škola, Moskva, 1982. 

ZALIZNJAK A. A., Ob effekte bližnej semantičeskoj evoljucii, PHILOLOGICA. Dvujazyčnyj žurnal po russkoj i teoretičeskoj filologii, N° 21/23, 2012, 11 – 22. 

Sitografia 

Malyj Akademičeskij Slovar’

(MAS) feb-web.ru/feb/mas/mas-abc/default.asp 

Nacional’nyj Korpus Russkogo Jazyka

(NKRJa) ruscorpora.ru/new/ 

Tolkovyj slovar’ Dalja

dic.academic.ru/contents.nsf/enc2p/ 

Tolkovyj slovar’ Ožegova

dic.academic.ru/contents.nsf/ogegova/ 

Tolkovyj slovar’ Ušakova https://dic.academic.ru/contents.nsf/

 

Paola Cotta Ramusino, Tatsiana Maiko - Collocazioni aggettivo+nome nell’uso di studenti italiani con russo L2

L’uso delle collocazioni da parte di studenti di lingua straniera costituisce un tema di grande interessein vari ambiti della linguistica, dalla glottodidattica alla linguistica cognitiva. La maggior parte deglistudi sono dedicati, naturalmente, alle collocazioni verbo+nome (Altenberg, Granger 2001, Nesselhauf 2005, Gilquin 2007, Laufer, Waldman 2011), e in parte alle collocazioni avverbio+nome (Hasselgren 1994, Granger 1998, Lorenz 1999, Men 2010).

L’uso delle collocazioni aggettivo+nome da parte degli apprendenti è a tutt’oggi meno indagato (Martelli 2006, Zhang, Chen 2006, Siyanova, Schmitt 2008), in particolare, non siamo a conoscenza di studi dedicati a tale argomento per la coppia italiano-russo.

La categoria stessa di “collocazione” ha ricevuto diverse interpretazioni. In prospettiva funzionale (Halliday 1966) e più propriamente statistica (Sinclair 1991), la si intende come una combinazione frequente, non casuale (stabile) di due o più lessemi, il cui significato è caratterizzato da una relativa trasparenza, combinazione la cui frequenza è maggiore rispetto alla frequenza degli elementi singolarmente presi (Копотев, Стексова 2016: 35, Sinclair 1991). In un approccio semantico, invece, si definiscono collocazioni combinazioni di parole caratterizzate da non composizionalità e compattezza lessicale (Cowie 1998, Hausmann 1989, Melčuk 1995). In questa seconda prospettiva, la collocazione è intesa come una struttura in cui un elemento, la base, viene scelto dal parlante e il secondo elemento, o collocato, è dipendente dalla base e prederminato dall’uso, e realizza il proprio significato solo insieme a una base (o alcune basi) (Hausmann 1989: 191-2).

Il nostro lavoro è dedicato all’analisi delle particolarità nell’uso delle collocazioni aggettivali da parte di studenti italiani con la lingua russa come L2. Ci siamo basate sui materiali di due learner corpora (corpora di apprendenti): il sottocorpus italiano del RLC (57185 слов) e la raccolta di testi non accademici prodotti dagli studenti dell’Università di Milano, attualmente caricato sul sito Sketch Engine e costituito da 88610 parole. Le collocazioni aggettivo+nome, estratte automaticamente e analizzate manualmente, sono state studiate dal punto di vista della deviazione lessicale in senso stretto e anche rispetto alla frequenza d’uso comparata a quella dei parlanti madrelingua (sulla base dei dati ricavati dal NKRJA, dal Russian Web 2011 e dal corpus di testi di studenti russi).

L’analisi di questi materiali ha messo in luce le seguenti tendenze, che saranno oggetto di discussione nel nostro intervento:

1) Altissima frequenza di alcuni aggettivi con significato generico (большой, новый, хороший, интересный, красивый, важный, главный), percepiti dagli studenti, probabilmente, come affidabili (cfr. “islands of reliability”, Dechert 1983: 193 e “lexical teddy bears”, Hasselgren 1994: 250).

L’aggettivo хороший, ad esempio, viene utilizzato dagli studenti al posto di aggettivi più specifici: хороший пример (cfr. яркий пример), хороший сотрудник (cfr. ценный сотрудник), хорошая атмосфера (cfr. приятная атмосфера), хороший результат (cfr. высокий результат), хорошая альтернатива (cfr. разумная альтернатива). La tendenza ad usare parole (non solo aggettivi, ma anche nomi e verbi) generiche e con un’ampia combinabilità al posto di soluzioni più specifiche ed appropriate è del resto caratteristica dell’interlingua in generale, come “strategia di ipergeneralizzazione” (Hussein 1990:128, Ringbom 1998:193).

2) Una tendenza del tutto contraria alla precedente, vale a dire l’utilizzo di aggettivi specifici (доходные дома, грамотныe сотрудники, въездной туризм), dovuta probabilmente all’input, in particolare alla microlingua di specialità.

3) Abbondante uso di aggettivi con generica funzione di intensificazione (решающий, грандиозный, приоритетный, ключевой, серьезный, глобальный, громадный, огромный, прекрасный, отличный, значительный, сильный).

4) Creazione di combinazioni nuove, frutto in genere di calco, al posto di collocazioni, sia quando nella L1 come nella L2 ci sia una collocazione (коричневые волосы ‘capelli marroni’ invece di каштановые волосы/capelli castani; первая школа it. scuola primaria, invece di начальная школа, большой случай it. grande occasione, nel russo più frequente хорошая возможность), sia nel caso in cui, piuttosto, nella L1 ci sia una combinazione libera e nella L2 una collocazione (it. occhi marroni, rus. коричневые глаза invece di карие глаза)

5) Influsso della L1, sempre attraverso calco, che si realizza selezionando il modificatore tra apparenti sinonimi (знакомые архитекторы, cfr. знакомый ≈ известный), o creando combinazioni nuove a partire da un sintagma (дипломные курсы it. corsi di laurea) della L1.

Keywords: russo come lingua straniera, collocazione, competenza collocazionale, learner corpus

Bibliografia:

Altenberg, B., Granger, S. 2001. The grammatical and lexical patterning of MAKE in native and nonnative student writing, “Applied Linguistics”, 22(2): 173-195.

Cowie, A.P. 1998. Introduction, in A.P. Cowie (ed.), Phraseology: Theory, Analysis, and Applications, Oxford: Oxford University Press.

Dechert, H.W. 1983. How a story is done in a second language, in C. Faerch, G. Kasper (eds.), Strategies in Interlanguage Communication, London: Longman, 175-196.

Gilquin, G. 2007. To err is not all. What corpus and elicitation can reveal about the use of collocations by learners, “Zeitschrift für Anglistik und Amerikanistik”, 55(3), 273-291.

Granger, S. 1998. Prefabricated patterns in advanced EFL writing: Collocations and formulae, in A. P. Cowie (ed.), Phraseology: Theory, analysis, and applications. Oxford: Oxford University Press, 145–160.

Halliday, M.A.K. 1966. Lexis as a Linguistic Level, “Journal of Linguistics”, 2(1), 57-67.

Hasselgren, A. 1994. Lexical teddy bears and advanced learners: A study into the ways Norwegian students cope with English vocabulary, “International Journal of Applied Linguistics”, 4(2), 237-260.

Hausmann, F.J. 1989. Le dictionnaire de collocations, in F.J. Hausmann, H.E. Wiegand, L. Zgusta,

(eds.), W.rterbücher, Dictionaries, Dictionnaires, Ein internationals Handbuch zur Lexikographie, Berlin: de Gruyter, 1010-1019.

Hussein, R. F. 1990. Collocations: The missing link in vocabulary acquisition amongst EFL learners, in Fisiak, J. (ed). Papers and studies in contrastive linguistics, Volume 26. The Polish-English contrastive project: 123˗136.

Laufer, B., Waldman, T. 2011. Verb-Noun Collocations in Second Language Writing: A Corpus

Analysis of Learners’ English, “Language Learning”, 61(2), 647-672.

Lorenz, G. 1999. Adjective Intensification – Learners versus Native Speakers: A Corpus Study of Argumentative Writing. Amsterdam: Rodopi.

Martelli, A. 2006. A corpus-based description of English lexical collocations used by Italian advanced learners, in E. Corino, C. Marello, C. Onesti (eds.), Proceedings XII EURALEX International Congress. Alessandria: Edizioni dell’Orso, 1005–1011.

Melčuk, I.A. 1995. Phrasemes in Language and Phraseology in Linguistics’, in M. Everaert, E.J. van der Linden, A. Schenk, R. Schreuder (eds.), Idioms: Structural and Psychological Perspectives, Hillsdale, New Jersey, Hove, UK, 167-232.

Men, H. Y. 2010. A corpus-based analysis of Chinese EFL learners’ adverb/adjective collocation errors in English writing. Internet Fortune, (4), 108–109.

Nesselhauf, N. 2005. Collocations in a Learner Corpus, Amsterdam: John Benjamins. Ringbom, H. 1998. High-frequency verbs in the ICLE Corpus, in Renouf A. (ed.) Explorations in Corpus Linguistics. Amsterdam – Atlanta, GA: Rodopi, 191– 200.

Russian Web 2011 (ruTenTen11), www.sketchengine.eu.

Sinclair, J. 1991. Corpus, concordance, collocation, Oxford: Oxford University Press.

Siyanova, A., Schmitt, N. 2008. L2 learner production and processing of collocation: A multistudy perspective. Canadian Modern Language Review/ La Revue Canadienne Des Langues Vivantes 64(3): 429–58.

Zhang, W. Z., Chen, S. C. 2006. EFL learners’ acquisition of English adjective-noun collocations—A quantitative study. Foreign Language Teaching and Research, 38(4), 251–258.

Копотев, М.В., Стексова, Т.И. 2016. Исключение как правило: Переходные единицы в грамматике и словаре, Москва: Языки славянской культуры.

Корпус русских учебных текстов, web-corpora.net/CoRST/search.

Национальный корпус русского языка, www.ruscorpora.ru.

Русский учебный корпус, http://web-corpora.net/RLC/search.

 

Malinka Pila - Funzioni delle forme non-finite del verbo in resiano, russo e sloveno

In un lavoro dedicato all’infinito in italiano, G. Skytte (1983: 22) definisce le “forme non-finite del verbo” come combinazione di una radice verbale con un flessivo cosiddetto non-finito. In italiano si contano quattro flessivi di questo tipo: -re per l’infinito; -to e -nte rispettivamente per il participio passato e presente e –ndo per il gerundio. Skytte precisa che il participio presente, tuttavia, ha raramente funzione verbale. 

Il verbo non-finito può esprimere opposizioni nell’ambito delle categorie di tempo, aspetto e diatesi, ma è generalmente escluso dalle categorie di persona e per la maggior parte delle forme anche di numero. Le forme non-finite del verbo sono lingua-determinate e il sistema di tali forme nelle lingue slave è generalmente più ricco e complesso di quello rilevato in italiano. Ciò dipende sia dal numero delle forme in questione, che oltre a infinito, participio, gerundio, comprende talvolta anche il supino (come in sloveno e resiano, ma non in russo); sia per il numero di flessivi cui si collegano le radici verbali (l’infinito russo, per esempio, esce in –t’, –ti, –č’). Inoltre, anche i rapporti della forma data con le varie categorie verbali e le loro funzioni variano da una lingua all’altra: per esempio l’infinito italiano, avendo una forma presente e passata, manifesta la categoria del tempo (+/-anteriorità) e, in più, della diatesi (attiva e passiva), ma è neutrale nei confronti dell’aspetto. Nelle lingue slave esso manifesta, invece, aspetto e diatesi, ma risulta estraneo alla categoria del tempo. 

In questo breve abstract ci si concentra sugli usi delle forme non-finite del verbo in resiano in confronto con russo e sloveno. Il resiano, lingua di ceppo sloveno sviluppatasi in condizione di contatto con le varietà romanze (e, in minor misura, tedesche meridionali), ma in esili rapporti con le varietà di sloveno, mostra alcuni usi “anomali” delle forme sopra citate, concentrati soprattutto nell’ambito dei participi e dell’infinito. Il supino, infatti, assente in russo, ma usato regolarmente in sloveno standard dopo i verbi di moto (es. grem spat.SUP ‘vado a dormire’ vs. hočem spati.INF ‘voglio dormire’), in resiano è in forte declino. Si contano, infatti, poche forme, che si differenziano da quelle dell’infinito per alternazione morfonemica, cf. jëst.INF : jist.SUP ‘mangiare’, o prät.INF : prat.SUP ‘lavare’ (Steenwijk 1992: 146). 

Anche il sistema dei gerundi in resiano è piuttosto scarno rispetto a quello di russo e sloveno. Si segnalano solo rari gerundi presenti con suffisso –ć e con valore di taxis (contemporaneità). È da notare, tuttavia, che alcune forme di gerundio presente sono ricavate da verbi perfettivi, per es. spadoć ‘cadendo’, pomarjoć ‘morendo’. 

Nella sfera dei participi il sistema più complesso è quello del russo, in cui oltre al participio in –l, si trovano forme attive e passive di participio presente e di participio passato. In sloveno si riscontrano, come in russo, il participio in –l e il participio presente attivo, ma il participio passato attivo è uscito ormai totalmente dall’uso letterario (Herrity 2000:193). Il participio passato passivo - formato generalmente, ma non solo, da verbi perfettivi - è, invece, molto produttivo. Anche in resiano quest’ultimo è piuttosto frequente, ma le forme imperfettive sono estremamente rare (Pila 2019). Peraltro in resiano qualche eccezionale esempio di participio presente attivo si trova soltanto nei testi poetici di R. Quaglia (2018: 76), in cui si riscontrano, tra le altre, le forme: skakajoći.NOM.PL.M ‘saltanti’ e smëjoći.NOM.PL.M 

‘(sor)ridenti’. Lo scarso uso del participio presente in resiano riflette la bassa frequenza che tale forma ha in italiano. 

L’antico participio in –l che in russo è diventato l’unica forma di passato, si trova in sloveno e resiano come parte del perfetto e del piuccheperfetto. In resiano, si notano sporadici esempi d’uso di questa forma in sostituzione di un’intera subordinata con valore di anteriorità nel passato, come in (1). Tale uso corrisponde a quello del participio passato passivo in italiano. 

(1) Paršly:PTCP dö na Bilo, somö se laǯali dvi nöći ta-na Bili [...]. (Steenwijk 1992: 193) 

‘Arrivati giù a S. Giorgio, abbiamo alloggiato due notti a S. Giorgio [...]’ 

Nell’ambito dell’infinito, invece, si rilevano in resiano due casi particolarmente interessanti, da ricollegare probabilmente al contatto linguistico. Il primo riguarda l’uso dell’infinito di un verbo perfettivo (!) in una costruzione di tipo locativo, che manifesta significato di contemporaneità rispetto all’azione principale. Tale costruzione, oltre a non essere tipicamente slava, contraddice la regola slava generale secondo cui la contemporaneità seleziona di norma l’imperfettivo. 

(2) Tu-w prït na nazëd somö se wstavili vïdët Marano. (Novi Matajur, periodico locale) 

‘Tornando indietro (lett. nel venire indietro) ci siamo fermati a vedere Marano.’ 

Il secondo caso si riferisce all’uso dell’infinito preceduto dalla costruzione costituita da una forma del verbo bet ‘essere’ + preposizione za ‘per’ + verbo principale. Tale struttura indica azione imminente ed è assente in russo e sloveno. 

(3) Trenö jë za se špartyt

‘Il treno sta per partire!’ 

Per concludere osserviamo che il resiano ha un sistema ridotto di forme non-finite rispetto a russo e sloveno: risultano vive e produttive solo le forme tipiche del parlato, ossia quelle dell’infinito e parzialmente dei participi, che presentano alcuni usi contatto-indotti molto probabilmente dalle lingue romanze di contatto (italiano e/o friulano). 

Abbreviazioni: 

INF = infinito 

PTCP = participio 

SUP = supino 

PL = plurale 

M = maschile 

Bibliografia 

Herrity, P. 2000. Slovene, a comprehensive grammar. London-New York: Routledge. 

Pila, M. 2019. Passivo e aspetto verbale in resiano, russo e sloveno. In: Krapova I., Nistratova S., Ruvoletto L. (a cura di), Studi di linguistica slava. Nuove prospettive e metodologie di ricerca. Venezia: Edizioni Ca’ Foscari. 439-451. 

Quaglia, R. 2018. Čütja. Presagi. Poesie dal 1985 al 1989. Pasian di Prato: Campanotto Editore. 

Skytte, G. 1983. La sintassi dell’infinito in italiano moderno, Vol. I. Copenhague: Munksgaard Forlag. 

Steenwijk, H. 1992. The Slovene dialect of Resia. San Giorgi. Amsterdam: Rodopi.

Vesselina Laskova - Insegnamento di L2 attraverso la traduzione orale

L’obiettivo di questa ricerca è illustrare i vantaggi dell’uso della traduzione orale come principale tecnica di insegnamento nello sviluppo della competenza linguistica negli studenti di L2.

Ai fini del nostro studio avremo bisogno di uno sguardo più dettagliato alla nozione di competenza linguistica (language proficiency), che è stata dichiarata di natura multidimensionale. Verso la metà degli anni Novanta il modello di Skehan (1996, 1998) definiva la competenza identificando tre componenti, che saranno analizzati nel presente studio: fluency, accuracy e complexity (d’ora in poi CAF). La ‘fluidità’ è definita come la capacità di produrre un discorso rapido e ininterrotto nella lingua di arrivo, analogamente a un madrelingua (cfr. Lennon 1990; Towell et al. 1996; Kormoz e Dénes 2004). La ‘accuratezza’ invece è la capacità di produrre strutture prive di errori (Hammerly 1991, Wolfe-Quintero et al. 1998). Il terzo componente - la ‘complessità’ - rimane fino ad oggi il più difficile da identificare e misurare. Probabilmente la sua definizione più comune è quella proposta da Ellis (2003), secondo il quale la complessità si riferisce alla “misura in cui il linguaggio prodotto nell’esecuzione di un compito è elaborato e vario” (Ellis 2003: 340).

Lo sviluppo della metodologia che sarà discussa nella presente relazione è stato direttamente ispirato da un fatto ben noto, ovvero che la fluidità è molto difficile da ottenere in una classe L2 e spesso rimane un obiettivo non raggiunto (cfr. Gatbonton & Segalowitz 2005 e Rossiter et al 2010). Come Rossiter et al. osservano a proposito del Communicative Language Teaching (CLT), “anche se molte metodologie […] promuovono la fluidità generale, non forniscono la ripetizione necessaria per raggiungere la fluidità automatica" (Rossiter et al. 2010, p. 585).

D’altra parte, se le attività di classe sono principalmente incentrate sullo sviluppo di competenze comunicative, ciò può portare al sottosviluppo della conoscenza delle caratteristiche formali di una lingua. In effetti, il CLT è stato criticato anche per aver sottovalutato il ruolo della grammatica (vedi ad esempio Ridge 1992 e Swan 1985 tra gli altri).

La domanda che si pone è dunque: possiamo sviluppare una metodologia di insegnamento che promuova sia fluidità che accuratezza? A questa domanda ne aggiungerò un’altra: tale metodologia può permettere di raggiungere gli obiettivi didattici in tempi più rapidi?

Guardando indietro nel tempo, si può osservare che tali interrogativi hanno già in parte ottenuto risposte nel metodo audiolinguistico. Il metodo audiolinguistico è tuttavia stato abbandonato per vari motivi, anche a causa del rapido sviluppo del campo glottodidattico nella seconda metà del Novecento, che, come nota Swan (1985), portò a scartare gli approcci precedenti ed esagerare i vantaggi di quelli nuovi: in particolare, gli apprendenti consideravano le attività pratiche estremamente poco interessanti e noiose, per cui negli anni seguenti le procedure basate sulla memorizzazione diretta furono abbandonate e sono rimaste una sorta di tabù fino ai giorni nostri.

A partire dagli ultimi decenni del XX secolo, tuttavia, l’insegnamento della grammatica e le attività legate alla produzione stanno gradualmente tornando al centro dell’interesse glottodidattico. Inoltre, con le metodologie CLT, il processo di apprendimento e il ruolo dello studente stesso hanno acquisito maggiore importanza. Lo sviluppo sul campo ha portato a un significativo miglioramento della progettualità didattica e delle tipologie di esercizi (come riconoscono persino i critici del CLT, cfr. Swan 1985). Tuttavia, la qualità dei risultati raggiunta attraverso il metodo audiolinguistico, nonché il loro rapido raggiungimento, supera quelli delle classi CLT.

Sembra quindi che uno sguardo critico al passato combinato con soluzioni innovative e l’applicazione delle moderne tecnologie potrebbe portare a una soluzione migliore al problema di trovare una metodologia di insegnamento più efficiente.

L’esperimento che verrà presentato è progettato per fornire una risposta alle seguenti domande:

1. La traduzione orale può essere utilizzata come tecnica d’insegnamento per sviluppare con successo la competenza linguistica (in termini delle sue tre componenti più comuni: fluidità, accuratezza e complessità)?

2. Tali obiettivi possono essere raggiunti solo attraverso attività in aula?

Si mostrerà inoltre come i risultati ottenuti attraverso l’insegnamento di una L2 mediante la traduzione orale differiscano da quelli raggiunti sulla base del metodo di insegnamento tradizionale a livello universitario.

 

Riferimenti bibliografici

Ellis, R. (2003). Task-based language learning and teaching. Oxford: Oxford University Press.

Gatbonton, E., & Segalowitz, N. (2005). Rethinking communicative language teaching: A focus on access to fluency. The Canadian Modern Language Review 61: 325–353.Hammerly, H. (1991). Fluency and accuracy: Toward balance in language teaching and learning. Clevedon: Multilingual Matters.

Kormoz. J and Dénes, M. (2004). Exploring measures and perceptions of fluency in the speech of second language learners. System 32/2: 145-64. 

Lennon, P. (1990). Investigating fluency in EFL: A quantitative approach. Language learning 40: 387-417.

Ridge, E. (1992). Communicative language teaching: time for review? SPIL PLUS 21: 95-108

Rossiter, J. R., T.M. Derwing, L.G. Manimtim and Thomson R.I. (2010). Oral Fluency: The Neglected Component in the Communicative Language Classroom.  The Canadian Modern Language Review 66/4, pp. 583-606.Skehan, P. (1996). Second language acquisition and task-based instruction. In J. Willis, & D. Willis (Eds.). Challenge and change in language teaching (pp. 17-30). Oxford: Heinemann.

Skehan, P. (1998). A cognitive approach to language learning. Oxford: Oxford University Press.

Swan, M. (1985). A critical look at the Communicative Approach. ELT Journal 39(1): 2-12.Towell, R., R. Hawkins, and Bazergui N. (1996). The development of fluency in advanced learners of French. Applied linguistics 17: 84-119.  

Wolfe-Quintero, K., S. Inagaki, and Kim H. –Y. (1998). Second Language Development in Writing: Measures of Fluency, Accuracy and Complexity. University of Hawai’i, Second Language Teaching and Curriculum Center.  

 

Sara Milani - Introduttori relativi in russo contemporaneo

Lo studio presentato, nel quadro della relativizzazione in russo contemporaneo, delinea una panoramica generale degli introduttori di frasi relative, atta a fornire i presupposti preliminari per una caratterizzazione più specifica della distribuzione contrastiva di kotoryj rispetto a kto, rispetto a kakoj e, in questa sede solo marginalmente, rispetto a čto (Milani 2019). La possibilità di avere un antecedente pronominale, condivisa peraltro anche da čto, ha caratterizzato kto e kotoryj come introduttori di relative light-headed (Čitko 1999), per le quali non è necessario l‟accordo di caso tra il pronome wh- all‟interno della dipendente relativa e l‟elemento selezionato dal predicato incassato. (1) a. [RC KtoNOM pridet pervym], polučit priz. (headless RC) „Chi arriverà primo riceverà un premio.‟ b. Ja sprošu u togoGEN, [RC ktoNOM pridet pervym]. (light-headed RC) „Io chiederò a quello che arriverà (per) primo.‟ c. * Ja sprošu u [RC ktoNOM pridet pervym]GEN. (headless RC) „Io chiederò a chi arriverà (per) primo. d. Ja sprošu u studenta, [RC kotoryjNOM /* ktoNOM pridet pervym]. (headed RC) „Io chiederò allo studente che arriverà (per) primo.‟ Come mostra il contrasto tra (1b) e (1c), in russo, come in polacco (Čitko 1999), soltanto le relative libere sono soggette al requisito di accordo di caso tra il pronome wh- all‟interno della dipendente relativa e l‟elemento selezionato dal predicato incassato: infatti, in (1c) il mancato accordo di caso rende la frase non accettabile; la piena grammaticalità di (1b) deriva, invece, sia dalla presenza del dimostrativo tot al genitivo, che soddisfa i requisiti di caso della preposizione reggente, sia dal caso nominativo del pronome relativo kto, richiesto dalla struttura argomentale del predicato incassato. Per quanto riguarda poi il tipo di pronomi relativi che possono introdurre le light-headed, sembra che in russo valga lo stesso paradigma polacco, come mostra il contrasto tra (1b) e (1d): infatti, le relative dotate di una testa lessicalmente realizzata (1d) ammettono kotoryj, escludendo l‟uso di kto, possibile invece in (1b). Tuttavia, va precisato che le light-headed in russo ammettono, oltre a kto, anche čto e kotoryj. Si è pertanto indagato l‟uso parallelo di kto e kotoryj come introduttori di relative light-headed ad antecedente pronominale, attestando, grazie a test di grammaticalità creati sia in isolamento sia in contesti discorsivi più ampi, che la scelta di un pronome rispetto all‟altro sta nella diversa matrice di tratti ad esso associata, per cui kto, [-individuale,-anaforico], rende l‟interpretazione del proprio antecedente pronominale indeterminata, non-specifica, mentre kotoryj, [+individuale,+anaforico], si intende in riferimento ad un antecedente specifico e contestualmente determinato. (2) Vse oni, naši dobrye znakomye, melko mysljat, melko čuvstvujut i ne vidjat dal’še svoego nosa — prosto-naprosto glupy. A te, [RC kotorye poumnee i pokrupnee], isteričny, zaedeny analizom, refleksom… (Čechov 1899, Zio Vanja, Atto II) „Tutti loro, i nostri buoni conoscenti, pensano poco, percepiscono poco e non vedono oltre il proprio naso—in breve sono semplicemente stupidi. Ma quelli che sono un po‟ più intelligenti e un po‟ più forti, sono isterici, divorati dall‟analisi, dalla riflessione…‟ 2 

In (2) la sostituzione di kotoryj con kto ha prodotto esiti non accettabili, lasciando intendere un antecedente generalizzato, non determinato e non certo riconducibile alla cerchia di antecedenti circoscritti dal contesto discorsivo. A confermare l‟ipotesi di un antecedente indeterminato per le relative a testa pronominale introdotte da kto sono stati sia gli esiti di frasi decontestualizzate come in (3-4), nelle quali la traduzione italiana cerca di rendere la differenza percepita dai parlanti intervistati, sia la possibilità per kto, ma non per kotoryj, di introdurre frasi relative libere, come in (5). (3) Te, [RC kotorye želajut ezdit’ na Kavkaz], mogut kupit’bilety zaranee. „Coloro di voi/ dei presenti i quali desiderino andare in Caucaso, possono acquistare i biglietti in anticipo.‟ (4) Te, [RC kto želajut ezdit’ na Kavkaz], mogut kupit’bilety zaranee. „Quelli che desiderano (chiunque desideri) andare in Caucaso, possono (può) acquistare i biglietti in anticipo.‟ (5) [RC Kto/ * kotoryj pojdet s nami v gory],dolžen vstat’ v šest’ utra. „Chi viene con noi in montagna deve alzarsi alle sei di mattina.‟ La distribuzione di kotoryj rispetto a kakoj, invece, è risultata dipendere dalla particolare semantica associata a quest‟ultimo, caratterizzato dal tratto [+similarità], che comporta una diversa identità referenziale rispetto all‟antecedente: totale con kotoryj, parziale nel caso di kakoj. Kakoj è ritenuto obbligatorio in costruzioni relative come la seguente, tratta da Švedova (1970: 517): (6) On uže ne tot čelovek, [RC kakimSTRUM on byl v universitete]. „Lui non è più quella persona che/quale era all‟università.‟ In secondo luogo, si è rivelata distintiva la presenza, sia nella principale sia nella dipendente relativa, di verbi in grado di reggere un predicato secondario (Spencer 1993); tali contesti escludono l‟occorrenza di kotoryj, come nell‟esempio seguente, tratto da Spencer (1993: 44). (7) Ja vernulsja ne tem čelovekomi STRUM, [RC kakimi STRUM/*kotorym i STRUM oni znali menja j v prošlom godu]. „Non sono più tornato la persona che essi conoscevano l‟anno scorso‟ (lett. quale essi conoscevano me l‟anno scorso)‟ Infine, la distribuzione complementare tra i due pronomi è stata osservata in relazione alla natura dell‟antecedente che, vincolata talvolta dal particolare contesto frasale (perfettivo o imperfettivo), per ragioni logico-pragmatiche, può richiedere una referenza disgiunta oppure di totale identità con il costituente relativizzato. Kakoj è risultato agrammaticale in quei contesti che richiedono la totale identità tra l‟antecedente e il pronome che introduce la relativa, come quando la testa indica una persona specifica (8) o quando la referenza disgiunta tra l‟antecedente ed il sintagma nominale relativo risulterebbe logicamente impossibile (9a). (8) Posle obeda prišla Nataša, [RC kotoruju/* kakuju vse ždali]. „Dopo pranzo è venuta Nataša, che tutti stavano aspettando.‟ (9) a. My šli po doroge, [RC kotoruju/ *kakuju postroiliPERF v prošlom godu]. „Noi camminavamo lungo la strada che hanno costruito l‟anno scorso.‟ b. My šli po doroge, [RC *kotoruju/ kakuju stroiliIMPERF v prošlom godu]. „Noi camminavamo lungo una strada che stavano costruendo l‟anno scorso.‟ In (9a) l‟uso di un verbo perfettivo al passato nella relativa indica che ci si sta riferendo ad una strada specifica, da cui si evince la grammaticalità di kotoryj; in (9b), invece, l‟aspetto imperfettivo del verbo generalizza l‟enunciato tanto da rendere possibile l‟uso di kakoj a scapito di kotoryj. 3 

Bibliografia

Alexiadou, Artemis, Paul Law, André Meinunger e Chris Wilder (a cura di). 2000. The Syntax of Relative Clauses. Amsterdam- Philadelphia, John Benjamins.

Cinque, Guglielmo. 2013. Typological Studies. Word Order and Relative Clauses. New York-London, Routledge.

Cinque, Guglielmo, Rizzi, Luigi. 2010. “The Cartography of Syntactic Structures”. In B. Heine e H. Narrog (a cura di) Oxford Handbook of Linguistic Analysis. Oxford, Oxford University Press, pp. 51-65.

Čitko, Barbara. 1999. “Light-Headed Relatives”, University of Pennsylvania Working Papers in Linguistics 7: 97-110.

Čitko, Barbara. 2000. Parallel Merge and the Syntax of Free Relatives. Ph.D. Dissertation, State University of New York at Stony Brook.

Falk, Yehuda N. 2010. “An Unmediated Analysis of Relative Clauses”. In M. Butt e T. HollowayKing (a cura di) Proceedings of the LFG10 Conference. CSLI Publications, pp.207-227.

Formanovskaja, Natalija Ivanovna. 1989. Solžnoe predloženie v sovremennom russkom jazyke. Mosca, Russkij jazyk.

Heim, Irene e Kratzer, Angelika. 1998. Semantics in Generative Grammar. Oxford, Blackwell Publishers.

Kallestinova, Elena Dmitrievna. 2007. Aspects of Word Order in Russian. Ph.D. Dissertation, University of Iowa.

Kayne, Richard S. 1994. The Antisymmetry of Syntax. Cambridge(Mass.), MIT Press.

Kayne, Richard S. 2005. Movement and Silence. New York, Oxford University Press.

Milani, Sara. 2019. “Relativizzazione e restrittività: alcuni criteri distintivi in russo”. In I. Krapova, S. Nistratova, L.Ruvoletto (a cura di) Studi di linguistica slava. Nuove prospettive e metodologie di ricerca. Studi e Ricerche, 20, Venezia, Edizioni Ca‟Foscari, pp. 313-326.

Sauerland, Uli. 2003. “Unpronounced Heads in Relative Clauses”. In K. Schwabe e S. Winkler (a cura di) The Interfaces. Deriving and Interpreting Omitted Structures. Amsterdam, John Benjamins, pp.205-226.

Spencer, Daryl. 1993. Aspects of the Syntax of Relative Clauses in Colloquial and Standard Russian. Ph.D. Dissertation, University of Toronto, Canada.

Švedova, Natal‟ja Ju. 1970. Grammatika sovremennogo russkogo literaturnogo jazyka. Moskva, Izdatel'stvo Nauka. 

Людмила Федорова - Спорные моменты русского словосложения: типологический и традиционный подходы

В докладе предполагается остановиться на некоторых спорных моментах словообразования, которые по-разному анализируются в русской грамматической традиции и в типологическом описании.

Последнее время значительное внимание привлекают проблемы русского словосложения; им посвящен ряд работ, в которых выделяются общие и специфические черты русских сложных слов в сопоставлении с другими языками. Русский материал в целом укладывается в общие типологические схемы, представленные в работах [Scalise, Bisetto 2009], [Guevara, Scalise 2009], [Scalise, Fábregas 2010], [Benigni, Masini 2009]; [Melloni, Bisetto 2010], [Forza, Guevara, Scalise 2009]. Однако русское словосложение обнаруживает ряд особенностей, которые не всегда легко уловить при отстраненном типологическом подходе. 

В соответствии с общей классификацией сложных слов, представленной в работах  [Scalise, Bisetto 2009], [Benigni, Masini 2009], русские сложные слова могут быть распределены на классы следующим образом

Субординативные

Атрибутивные

Координативные

эндо-

экзо-

эндо-

экзо-

эндо-

экзо-

военачальник

домохозяйка

пароход

сорвиголова

сухофрукты

темно-синий

сухогруз

синеглазый

черно-белый

диван-кровать

северо-запад

Австро-Венгрия

Способом образования сложных слов считается сложение компонентов, в морфологическом отношении представляющих собой корни, основы, слова, усеченные слова, словоформы, аффиксоиды. При этом в процессе могут участвовать соединительные гласные и суффиксы. Образования с участием суффикса квалифицируются как парасинтетические.

В русском языке возникает проблема разделения экзоцентрических и эндоцентрических образований. Экзоцентрическим считается образование, в котором целое не является гипонимом по отношению ни к одному из своих компонентов. Например, прилагательные «неотчуждаемой принадлежности» типа синеглазый нельзя трактовать как гипоним к *глазый, поскольку такое слово отсутствует. Принято считать, что в образовании таких прилагательных участвует нулевой суффикс в роли адъективайзера, но он не способен выполнять функцию «головы» [Федорова 2015].

В русской грамматике есть два подхода к трактовке таких прилагательных. Один (в АГ-80) соответствует принятому в типологическом подходе признанию нулевого суффикса в суффиксально-сложном образовании (что соответствует термину «парасинтетическое»). Здесь фиктивная величина (нулевой суффикс) требуется, чтобы обосновать переход от основы глаз- к прилагательному. При другом подходе образование прилагательного описывается одновременным присоединением левой основы и флексии, которая указывает лексическую категорию целого и соотносит признак с его обладателем. Этот способ обозначается как сложно-флексийный [Немченко 1984]; при таком анализе можно было бы считать такие прилагательные эндоцентрическими.

Таким образом, для обоих подходов в русской грамматике признается смешанный способ образования. Другой случай смешанного образования – это префиксально-суффиксальные прилагательные типа подводный, беззубый, которые в типологическом обзоре отнесены к сложным словам с первой основой – предлогом [Benigni, Masini 2009]. В русской грамматике предлоги не считаются корневыми образованиями (по крайней мере первообразные предлоги), и при объединении предложного сочетания они переходят в префиксы. Так устроен ряд моделей существительных и прилагательных с без-/бес-, за-, на-, по-, под-, пред-, при- и  разными суффиксами (в том числе и нулевым в образованиях с без-/бес-). Но можно заметить, что так же устроены образования с префиксами вз-/вс-, пере-, раз-/рас-, для которых нет параллельных предлогов. Представляется оправданным относить к одной модели при-морь-е и вз-морь-е, под-лес-ок и пере-лес-ок, а также вз-горь-е, пред-горь-е, вс-поль-е, за-речь-е, по-бережь-е и ряд традиционных топонимов: За-кавказь-е, По-волжь-е, При-ураль-е, За-карпать-е; возникают и новые образования – закулисье, забугорье, заквартирье. Аналогично и прилагательные при-бреж-ный, пред-гор-ный и др. естественно рассматривать как простые, а не сложные слова. Впрочем, надо отметить, что образование прилагательных на базе предложной конструкции (типа настенный, подводный) рассматривается в рамках словосложения в работах [Гращенков 2016-а, 2016-b] – на основании прозрачности семантики для автоматического анализа текста.

Итак, для русского словообразования традиционно отмечаются смешанные способы (суффиксально-сложный, префиксально-суффиксальный), причем предлоги при образовании новых слов приобретают характер префиксов. В типологическом обзоре на материале 23 языков в базе Morbo/Comp предлоги рассматриваются как полноправные компоненты словосложения, отмечены даже модели [Pre+Pre]. Если быть последовательным, то и русские предлоги из-за, из-под тоже должны рассматриваться при этом подходе как сложные слова, однако в обзоре [Benigni, Masini 2009] этого не отмечено.

В целом, типологический подход дает возможность широкого сопоставления материала разных языков и выделения универсальных тенденций, однако иногда взгляд в глубину позволяет дополнить общую картину.

 

Литература

АГ – Русская грамматика, т.1. / Под ред. Н.Ю. Шведовой. М., 1982.

Гращенков П.В. Сложные прилагательные, бинарное ветвление и выбор синтаксического формализма // Рема, 2016-а, №3. М. 75–96.

Гращенков П.В. Автоматический анализ русских сложных слов // Вестник Московского университета. Серия 9: Филология. 2016-b. № 6. С. 119-132.

Немченко В.Н. Современный русский язык. Словообразование. М., 1984.

Федорова Л.Л. Сложные прилагательные неотчуждаемой принадлежности в русском языке // Вестник РГГУ. Серия «История. Филология. Культурология. Востоковедение». Московский лингвистический журнал. 17(2), 2015, с. 61-74.

Benigni V., Masini F. Compounds in Russian // Lingue e linguagio VIII.2 (2009) 171–193.

Forza F., Guevara E., Scalise S. Compounding adjectives // Lingue e linguaggio VIII 1 (2009) 137-162.

Guevara E, Scalise S. Searching for universals in Compounding // Universals of Language today. / S. Scalise, E. Magni, A. Bisetto (eds.). Dordrecht: Springer. 2009. 101-128.

Melloni C., Bisetto A. Parasynthetic compounds: Data and theory // Cross-Disciplinary Issues in Compounding. / S. Scalise, I. Vogel (eds.), Amsterdam/Philadelphia: John Benjamins. 2010. 199-218.

Scalise S., Bisetto A. The classification of compounds // The Oxford Handbook of Compounding / P. Steckauer, R. Lieber (eds). Oxford University Press, 2009.

Scalise S, Fábregas A. The head in compounding // S. Scalise, I. Vogel (eds.), Cross-Disciplinary Issues in Compounding.109-125.

 

Mirko Sacchini - Il prefisso za-: significato e aspetto verbale nello Slovo o Polku Igoreve

I verbi con il prefisso anticorusso za- dello Slovo o polku Igorevevengono qui classificati nel loro significato e nelle loro proprietà aspettuali per ricondurli ad articoli di glossario. Questo per rivelarne il paradigma tempo-aspettuale (‘coppie aspettuali’) al tempo dello Slovo e fare luce su alcuni dei loro significati “oscuri”.

Per ovviare all'assenza dell'originale e dei testimoni antichi, nonché alla presenza di ipercorrezioni nelle prime edizioni, i verbi con za- ed i loro contesti sono stati attinti dal testo critico di Zalyznjak (2004). Inoltre abbiamo sancito l'assenza nello Slovo di forme con un “falso” za- come zostati (‘rimanere’), non avente un prefisso za- ma iz- nella forma polacca zo- (SRJa XI-XVII: vol.6, p.62), grazie alla rappresentazione spaziale basica (RB) dell'elemento prefisso-preposizionale za (in balto-slavo un avverbio autonomo (Tabačenko 2016)), da cui gli usi spaziali e astratti del prefisso za sono derivati: ‘dietro/oltre il punto osservato’.

Partendo dalla RB di za-, tutti i suoi significati sono inquadrati in quattro tipi di valore prefissale, legati l'uno all'altro da rapporti di crescente analogia: solo spaziale, spaziale-risultativo, temporale-risultativo, solo risultativo(Bermel 1997, Dmitrieva 2005). Sebbene nelle classificazioni sincroniche questi quattro valori non siano fondamentali (Anna Zalyznjak 2006), in quelle diacroniche lo sono: con essi è infatti possibile predire per un verbo prefissato quale specie di concetti e quale classe azionale (activity, state, accomplishment, achievement) debba riflettere il suo significato di vocabolario, nonché come esso possa morfofunzionalmente derivare la coppia (Sacchini 2014). Ju.S. Maslov (Sacchini 2014) e Bermel vedono già nelle primissime fasi del russo antico come la prefissazione non arricchisca solo il lessico verbale, ma crei anche verbi di azione terminativa, cioè di cambiamento processuale (accomplishments) o puntuale (achievements), marcati da risultatività, ovvero concepiti come atti già assolutamente conclusi (perfettivi, Pft) nel passato o nel futuro rispetto al momento di riferimento. Grazie a E.V.Padučeva, Ju.S. Maslov e P.J.Mayo (in Sacchini 2014) capiamo che il tipo di valore prefissale, attivato da un lemma con za- in un certo contesto, selezioni la struttura azionale (predel'naja, trivial'naja, perfektnaja, proleptičeskaja) e morfologica (tramite sostituzione della base, suffissazione o deprefissazione) della coppia con l'imperfettivo (Impf.) non-risultativo.

1.Valore solo spaziale: già all'inizio del russo antico era raro, derivando solo verbi Impf. non-terminativi della classe states privi di coppia,i cui significati solo concreti derivati dalla RB erano utilizzabili solo per fatti immutabili: per le descrizioni geografiche o gli atti ripetuti negli anni. Non ci sono verbi di questo tipo nello Slovo. Nei dizionari di russo antico (SDJa XI-XIV, SRJa XI-XVII e Sreznevskij) troviamo i lemmi zaležati (‘giacere dietro a qualcosa per tendere un'imboscata’) e, seppure, già con un significato astratto, zavideti (‘invidiare, vedere non qualcuno ma i possessi dietro di lui’)

2.Valore spaziale-risultativo: crea verbi Pft. di accompliment formanti (a meno di idiosincrasie) coppie predel’nye con suffissazione (con -a- o -yva-) o rimpiazzamento della base. Seguendo Janda (1986) e Anna Zalinznjak (2006), la RB di za- ed i tipi di avverbiali spaziali nei loro contesti, possiamo classificare i 10 verbi spaziali-risultativi dello Slovo come segue: 2.1.‘behind’ (1 caso): la forma slavo-orientale al presente (XII. 69: Igor’ pl”ky zavoročaet)del lemma zavratiti (‘volgere indietro’: Pft. zavorotiti - Impf. zavoročati); 2.2. ‘far’ (3 casi): tutti associati ad un avverbiale di allontanamento: 1.l'aoristo Pft. zajde di zajti (‘allontanarsi a piedi’: Pft. zajti - Impf. zachoditi): XIII.79:O! daleče zajde sokol..”;2. il perfetto senza ausiliare Pft.zaletĕlodizaletĕti (‘volare via da’: Pft. zaletĕti – Impf. zaletati):VII.40.Olgovo chorobroe gn”zdo...daleče zalet”lo; 3. l'aoristo Pft. zanese di zanesti (‘portare via’: Pft. zanesti – Impf. zanositi): III.16.“Ne burja sokoly zanese čres polja širokaja; 2.3. ‘cover’ (anche come ‘close’, ‘hide’, ‘fill’) creante verbi transitivi (6 casi): zagorodite, forma slavo-orientale all'imperativo Pft. di zagraditi (‘sbarrare il passaggio al nemico’) nel fraseologismo militare con vorota (‘le porte della città’): XXII.142: “Mstislaviči…Zagorodite polju vorota!”.La coppia si rivela solo nella forma slavo-meridionale del lemma(almeno dal XIII secolo): Pft. zagraditi - Impf. zagraždati; 2. l'imperfetto Impf. zakladaše di založiti/zaklasti (‘otturare’: Pft. založiti/zaklasti - Impf. zakladati): XI.58: “A Vladimir... uši zakladaše” ; 3-4-5. tre occorrenze di zastupiti (Pft. zastupiti – Impf. zastupati): due nel significato di ‘ostacolare il cammino’: l'imperfetto Impf. zastupaše(IV.27: “Solntse emu t”moju put' zastupaše”) e il participio Pft. zastupiv” (XX.130: “Jaroslav[e]...zastupiv” korolevi put”; una, l'aoristo Pft. zastupi, in quello simbolico di annebbiare: II.12: “žalost' emu znamenie zastupi; 6. l'aoristo Pft. zatče di zat(”)kati/zatyknuti (‘serrare’: Pft. zat(”)kati/zatyknuti - Impf. zatykati): XXVI.183:Čemu, gospodine,..im tuli zatče?”.

3. Testimonia l'arcaicità dello Slovo l'assenza di verbi temporali-risultativi, sia nell'uso 3.1. incoativo-ingressivo begin (nei vocabolari: zagremeti (iniziare a tuonare) e zagnevatisja (‘cominciare sempre più ad adirarsi’)) che 3.2. intensivo-risultativo ‘excess (zamučiti (‘sfinire qualcuno tormentandolo’). Malygina (1993) e Godisova (2008) che li studiano, oltre a vederne l'origine dallo RB di za-, ne attestano la sporadicità fino al XV secolo.

4.Valore solo risultativo (6 casi): il prefisso “duplica” o “si fonde” nel verbo derivato, creando anche coppie perfektnye e proleptičeskie prima impossibili. Troviamo qui i 4 verbi che nello Slovo utilizzano la deprefissazione (senza però cancellare le precedenti coppie suffissate!) per formare l'imperfettivo: 1.il participio Pft. zakalena di zakaliti (‘temprare: coppia predel'naja Pft. zakaliti - Impf. zakalati; Pft. zakaliti - Impf. kaliti (dal XII-XIII secolo): XVI.113: “Vaju chrabraja serdtsa...v” buesti zakalena”;2.l'aoristo Pft. zareza di zarezati (‘uccidere: coppia trivial'naja Pft. zarezati – Impf. zarezàti; Pft. zarezati - Impf. rezati (dal XII secolo): I.4:Mstislav[u], iže zar”za Rededju”; 3-4. il fraseologismo militare zatvoriv” vorota (significato 1) e zatvoru Rostislava (significato 2) di zatvoriti (1.‘chiudere le porte’, 2. ‘imprigionare’: coppia predel'naja (nel significato 1)e perfektnaja (nel significato 2): Pft. zatvoriti – Impf. zatvorjati; Pft. zatvoriti - Impf. tvoriti (dal XVI-XVII secolo): XX.130: “Jaroslav[e]..zatvoriv” Dunaju vorota” // XXVIII.197.r”ka Stugna...knjazja Rostislava zatvori dn””. Ma vi troviamo anche 2 verbi il cui prefisso poteva essere ritenuto parte della radice di un verbo semplice (il participio Pft. zabyv” di zabyti (‘dimenticare’: coppia perfektnaja Pft. zabyti – Impf. zabyvati): X. 56: “zabyv” čti i života”) oppure apparire senza una semantica chiara (il perfetto Pft. senza ausiliare zapala del lemma senza incoatività (Lichačëv 1950: 399) zapasti (‘spegnersi’): coppia predel'naja (Pft. zapasti – Impf. zapadati) probabilmente dall'XI secolo: V.33-36: “Zarja sv”t” zapala” .

 

Bibliografia

  1. Bermel, N. (1997). Context and Lexicon in the Development of Russian Aspect. Berkeley (Ca): University of California Press.
  2. Dmitrieva, О.I. (2005). Dinamičeskaja model' russkoj vnutriglagol'noj prefiksacii. Saratov: Izdatel'stvo Saratovskogo universiteta.
  3. Godisova, Z.I. (2008). “Formirovanie semanticheskoj struktury pristavki za-”. In Vestnik Sankt-Peterburskogo universiteta.Ser.9, Vyp. 2.II. Sankt-Peterburg: 112-118. https://cyberleninka.ru/article/n/formirovanie-semanticheskoy-struktury-pristavki-za
  4. Janda, L.A. (1986). A semantic analysis of the Russian verbal prefixes za-, pere-, do-, and ot-, Slavistische Beiträge, Band 192, München, Verlag Otto Sagner: 78-133.
  5. Lichačëv, D.S. (1950). Slovo o polku Igoreve (pod redakciej) V.P.Adrjanovoj-Perec. Moskva-Leningrad: Izdatel'stvo Akademii Nauk SSSR.
  6. Malygina, Е.N. (1993).Razvitie načinatel'nogo sposoba glagol'nogo dejstvija v russkom jazyke XI-XVII vv. Moskva: RAN Institut Russkogo Jazyka (avtoreferat dissertacii).
  7. Sacchini, M. (2014). Proto-coppie nella Zadonščina. A proposito dei rapporti fra morfologia derivazionale ed aspettualità in antico russo [Tesi di dottorato]. Padova: Università di Padova.
  8. SDJa XI-XIV - Slovar’ Drevnerusskogo Jazyka XI-XIV vv. (1988-2008), voll. I-VIII. Avanesov, Roman I. (a cura di). Moskva: IRJa RAN im. V.V. Vinogradova.
  9. Srez - Sreznevskij, I.I. (1893). Materialy dlja SlovarjaDrevne-russkagoJazykapopis’mennympamjatnikam”. Sankt-Peterburg: Tipografija Imperatorskoj Akademii Nauk”.
  10. SRJa XI-XVII - Slovar’ russkogo jazyka XI-XVII vv. (1975-2008), voll. 1-28. Moskva: IRJa RAN im. V.V. Vinogradova.
  11. SSSPI - Slovar’– spravočnik Slova o polku Igoreve (1965-1984), voll. I-VI. Vinogradov, Vladimir (a cura di). Leningrad: АN SSSR. Institut russkoj literatury (Puškinskij Dom).
  12. Tabačenko, L.V. (2016). “Russkoe pristavočnoe vnutriglagol'noe slovoobrazovanie v svete indoevropejskich istokov”. In Izvestija Južnogo Federal'nogo Universiteta. Filologičeskie nauki. N.4: 161-167. https://philol-journal.sfedu.ru/index.php/sfuphilol/article/view/978
  13. Zaliznjak, А.A. (2004). Slovo o polku Igoreve. Vzgljad lingvista. Moskva: Jazyki Slavjanskoj Kul’tury.
  14. Zaliznjak, Anna A.; Šmelëv, Andrej D. (2000). Vvedenie v russkuju aspektologiju. Moskva: Jazyki Russkoj Kul’tury.
  15. Zaliznjak, Anna A. (2006). Mnogoznačnost' v  jazyke i sposoby eë predstavlenija. Moskva: Jazyki Slavjanskoj Kul'tury: 298-335.

Marina Gasanova Mijat - La coniugazione dei verbi russi: alla ricerca dei criteri per riconoscere il modello

Contenuto della relazione:

  1. Perché questo studio?
  2. Procedimento dell’analisi
  3. Macrogruppi di verbi e i tipi di coniugazione
  4. Microgruppi: esempi di alcuni modelli
  5. Bibliografia

1. Esistono diversi studi sulla tipologia dei verbi russi – a volte più sintetica, a volte più ampia e dettagliata — che descrivono classi verbali produttive e gruppi improduttivi (vedi ad es. Zaliznjak, Budaj, Beljakova). È un modo di classificare i verbi basato sulla presupposta conoscenza dei paradigmi di coniugazione e della posizione dell’accento, quindi adatto ai russofoni ma inutilizzabile per coloro che studiano il russo come lingua straniera. Le informazioni lessicografiche in parte suppliscono questa lacuna: nella maggior parte dei dizionari sono fornite le forme del verbo alla prima e/o seconda persona singolare e alla terza persona plurale, che indicano l’eventuale alternanza della consonante finale del tema e la posizione dell’accento, nonché l’aspetto verbale e, a volte, la relativa coppia aspettuale. Alcune risorse lessicografiche online specificano inoltre l’indice del verbo secondo la classificazione di Zaliznjak. Tutto ciò non fornisce però al discente non russofono elementi sufficienti per capire come coniugare un verbo partendo dai primari ed essenziali dati a sua disposizione, e non lo aiuta a visualizzare un quadro chiaro e completo del sistema di coniugazione verbale in russo. L’obbiettivo della ricerca dunque è individuare eventuali tratti distintivi che permettano di riconoscere l’appartenenza del verbo alla 1° o alla 2° coniugazione, nonché il tipo e la specificità del paradigma.

2. Al primo approccio con un verbo lo studente ne apprende le informazioni di base, ovvero: il suo significato, le sue caratteristiche formali, fonetiche ed aspettuali. Questi dati sono stati esaminati nel seguente ordine:

- il morfema finale dell’infitito (-ть, -ти, -чь) e l’ultima vocale o consonante del tema, che definiscono l’appartenenza del verbo ad un macrogruppo;

- l’eventuale appartenenza del verbo ad un circoscritto gruppo semantico;

- le specifiche delle forme verbali al presente e al futuro perfettivo (mantenimento o troncamento della vocale finale del tema, eventuale alternanza dell’ultima consonante, eventuale presenza di una vocale mobile o della riduzione vocale all’interno della radice ecc.);

- la posizione del tonema (accento fisso, accento costante sulla desinenza, accento mobile);

- la formazione della coppia aspettuale (prefissale, suffissale, ibrida o suppletiva).

3. Una volta appeso che tutti quei verbi che all’infinito terminamo con le desinenze -ти o -чь, oppure con la desinenza -ть precenduta da una consonante o dalle vocali о, у,ыappartengono alla I coniugazione, lo studente si trova ad affrontare quelli che rappresentano l’assoluta maggioranza dei verbi russi, ovvero quelli con la desinenza -ть preceduta dalle vocali а,е,и,я, e che possono fare parte sia della I che della II coniugazione. Si tratta quindi di rilevare le proprietà che regolano la coniugazione dei verbi che terminano in -ать/-ять, in -еть e in -ить.

4. Nel corso della ricerca sono stati individuati diversi microgruppi, sia all’interno dei macrogruppi contententi i verbi dello stesso tipo di coniugazione, sia all’interno dei macrogruppi che includono i verbi della I e della II coniugazione. Sono stati identificati alcuni microgruppi i cui elementi sono uniti da un comune componente semantico. Ad es.: i verbi in -еть caratterizzati dai componenti semantici “cambiare colore/sfumatura/gradazione” e “cambiare lo stato fisico/mentale/emotivo/economico” appartengono alla I coniugazione e mantengono la vocale tematica (краснeть,темнeть,худeть,умнeть,веселeть,богатeть, ecc.). Esistono inoltre i tratti semantici “trasversali” che accomunano verbi di diversi macrogruppi in base al loro significato e al tipo di coniugazione. Ad es.: all’interno dei macrogruppi in -ать/-ять e in -еть (nei quali la maggioranza dei verbi appartiene alla I coniugazione) si rilevano i microgruppi che contengono i verbi della II coniugazione appartenenti al campo semantico “emmettere un suono” (cfr. кричать,мычать,пищать,ворчатьeшумeть,свистeть,кряхтeть). Un altro caso è rappresentato dai verbi di posizione лежать, стоять, сидеть, висеть che fanno parte della II coniugazione.

Tra le caratteristiche formali che determinano il tipo e il modello di coniugazione possiamo trovare diversi morfemi: la radice (ad es.: -каз-/-каж-, -ним-/-н-, -шиб- indicano l’appartenenza alla I coniugazione, mentre -сто- alla II) oppure il suffisso (ad es.: -ыва-/-ива- e -ну- caratterizzano una serie di microgruppi della I coniugazione). Un altro indizio è il suono che precede la vocale finale del tema. Così, i verbi in -аять, -еять, -иять, -уять (ad es.: ваять, лаять, сеять, надеяться, влиять,чуять e al.) appartengono alla I coniugazione, invece quelli in -оять (ad es.: боя́ться,стоя́тьe al.) alla II coniugazione.

Un altro dei parametri che indicano il tipo e il modello di coniugazione è il “rapporto” tra due elementi all’interno della coppia aspettuale. Ad es., se la forma dell’inperfettivo termina in -ать/-ять mentre quella del perfettivo in -ить, spesso con l'alternanza della consonante finale del tema, queste, di regola, appartono relativamente alla I e all II coniugazione. (cfr. решать/решить, изменять/изменить, отвечать/ответить, прилагать/приложить, побеждать/победить, добавлять/добавить).

 

5. Bibliografia:

Белякова Н.Н. Как строится русский глагол? Санкт-Петербург, Златоуст, 2002.

Будай В. Г. Алгоритм словоизменения русских глаголов. Санкт-Петербург, Златоуст, 2012.

Зализняк А.А. Грамматический словарь русского языка. Изд. 4-е. Москва, Русские словари, 2003.

Куринина Г.П. Учим русские глаголы: Словарь-справочник для иностранцев. Москва, Издательство Российского университета дружбы народов, 2000.

Слабухо О.А. Спряжение глаголов на занятиях по русскому языку как иностранному: концепция и модель обучения. «Современные проблемы науки и образования», 2016, № 2. http://www.science-education.ru/ru/article/view?id=24337 (дата обращения: 10/07/2020)

Слабухо О.А. Проблема классификации моделей спряжения глаголов в методических целях обучения русскому языку как иностранному. «Молодой учёный», № 12 (92), 2015, с. 962-965. https://moluch.ru/archive/92/20490/ (дата обращения: 10/07/2020)

Слабухо О.А., Бабенко И.И. Спряжение русского глагола: проблемы лингводидактического описания категории и модель обучения спряжению на уроках русского языка как иностранного.  https://cyberleninka.ru/article/v/spryazhenie-russkogo-glagola-problemy-lingvodidakticheskogo-opisaniya-kategorii-i-model-obucheniya-spryazheniyu-na-urokah-russkogo (дата обращения: 10/07/2020)

Cadorin E., Kukushkina I. I verbi russi. Milano, Hoepli, 1999.

Cevese C., Dobrovolskaja J., Magnanini E. Grammatica russa. Milano, Hoepli, 2000.

 

Valentina Noseda - Le particelle razve e neuželi alla luce del Corpus parallelo russo-italiano

Lo scopo della presente indagine è esaminare le particelle interrogative razve e neuželi alla luce dei dati restituiti dal Corpus Parallelo italiano-russo del Nacional’nyj Korpus Russkogo Jazyka. Da un lato, analizzando i contesti d’uso saremo in grado di confermare, correggere o approfondire i risultati dei principali studi sui due lemmi. Dall’altro, l’analisi del Corpus interrogato in entrambe le direzioni consentirà di avanzare alcune riflessioni pertinenti agli studi traduttivi. L’utilità dei corpora paralleli per lo studio delle parole discorsive è confermata – con particolare riferimento al russo e all’italiano – da diversi studi recenti tra cui (Biagini, Bonola 2019 e Bonola, Noseda 2020).

Razve (R) e neuželi (N) vengono definite come due particelle interrogative che rappresentano l’atteggiamento del parlante nei confronti di una data porzione di realtà, e per questo motivo sono da considerarsi particelle modali (Baranov 1986:127). Nello specifico, le funzioni dei due lessemi sono molto varie, ma non sempre la lessicografia russa, che spesso tratta queste due particelle come sinonimi, le illustra in modo appropriato. Pertanto, soprattutto dagli inizi degli anni Ottanta, diversi studiosi si sono proposti di indagarne più a fondo la semantica e gli usi cercando innanzitutto di evidenziare i tratti distintivi. Sintetizzando le descrizioni proposte in Bulygina e Šmelev (1982), Rathmayr (1985), Baranov (1986), Apresjan (1986), Karoj (1994), il quadro che emerge è il seguente:

Razve

Neuželi

1) il parlante è convinto che non P e chiede all’interlocutore di confermare P.

1) il parlante non sapeva che P e chiede all’interlocutore di confermare P.  

2) ‘Non P’ per il parlante è un fatto.

2) ‘Non P’ per il parlante è una supposizione.

3) Esprime l’atteggiamento negativo del parlante che, per qualche motivo o circostanza, è portato a presupporre P.

3a) Esprime l’atteggiamento negativo del parlante che, per qualche motivo o circostanza, è portato a presupporre P e ne teme le conseguenze. Il parlante, tuttavia, non entra in conflitto con l’interlocutore.

3b) Non esprime necessariamente l’atteggiamento negativo del parlante

4) P suscita nel parlante dubbio e sorpresa.

4) P suscita nel parlante innanzitutto sorpresa e in parte dubbio.

5) È più razionale.

5) È fortemente emozionale, P è rilevante per il parlante.

L’indagine corpus-based che presentiamo muove da queste definizioni. Gli esempi rintracciati nel corpus parallelo ru-it (composto da originali russi tradotti in italiano) sono stati innanzitutto classificati in base a due criteri: i) il tipo di frase interrogativa; ii) i tratti semantici individuati nei lavori sopracitati.

L’analisi di circa 200 occorrenze dimostra che R è usato nella maggior parte dei casi nelle interrogative retoriche. In esse il tono è frequentemente contrariato, ma non sempre il parlante entra in conflitto con l’interlocutore: talvolta, infatti, la domanda è pronunciata in un contesto monologico. Non mancano inoltre i casi in cui anche nell’interrogativa retorica il tono del parlante rimane neutro. Seguono, per frequenza, le interrogative canoniche con funzione di constatazione. Si osserva che R nella maggior parte dei casi occorre in proposizioni emotivamente non marcate: il parlante non sapeva che P (o era convinto che non P) e chiede conferma all’interlocutore, ma senza mostrarsi irritato o spiacevolmente sorpreso. Infine R compare in alcune interrogative orientate (spesso tradotte in italiano con formule come non credi che?). In questo caso R. si inserisce in un atto illocutorio indiretto che incoraggia l’interlocutore ad aderire all’opinione del parlante.

N è invece usato principalmente nelle interrogative canoniche con funzione di constatazione, sebbene in alcuni casi la linea che separa questo tipo di frasi e le interrogative retoriche sia molto sottile. Infatti, N esprime l’incredulità del parlante nei confronti di P, ma talvolta manca una vera e propria richiesta di conferma in quanto la risposta è sottintesa. Ciò conferma, da un lato, quanto osservato da Apresjan (1986), secondo cui la funzione prototipica di N sarebbe informare l’interlocutore del proprio stupore e, dall’altro, le osservazioni di Bulygina e Šmelev (1982), per cui, con N, P è rilevante per il parlante. Alla luce degli esempi analizzati aggiungeremo che, oltre a stupore, il parlante non di rado esprime il proprio disappunto e lascia trasparire un giudizio negativo nei confronti di P e/o del garante di P.

Se consideriamo solo le interrogative canoniche, gli esempi sembrerebbero confermare che N è emotivamente più marcato ed esprime innanzitutto sorpresa. R, al contrario, più razionale, è usato principalmente per confermare un fatto precedentemente ignorato dal parlante. Pertanto, rispetto a N, R svolge anche una funzione discorsiva di cessione del turno (Biagini, Bonola 2019: 60). Allo stesso tempo si evince che R non compare necessariamente in contesti negativi, mentre N, associato molto spesso ad un tono contrariato, non esclude una situazione di conflitto fra il parlante e l’interlocutore. In N., dunque, prevalgono i valori pragmatici, a discapito di una funzione meramente discorsiva.     

La seconda parte dell’indagine considera più nel dettaglio le versioni italiane. Si contano 27 traduzioni per R (tra cui prevale nettamente forse) e 17 per N, (tra cui si evidenziano locuzioni come possibile che, è mai possibile?). L’elevato numero di traducenti suggerisce la ‘linguospecificità’ di R e N (Inkova 2017). Per un confronto il Corpus è stato successivamente interrogato in direzione inversa, osservando le traduzioni russe di testi italiani. I risultati mostrano che nell’82% dei casi R non corrisponde ad alcun elemento linguistico in italiano, mentre nel corpus ru-ita solo il 22% degli esempi non viene tradotto. La stessa tendenza si osserva per N: nel corpus ita-ru, nel 76% dei casi la particella non presenta un corrispettivo italiano, mentre nel corpus ru-ita ciò si verifica per il 18% degli esempi. Questo sembrerebbe confermare alcune delle teorie sulla cosiddetta lingua delle traduzioni e sugli universali traduttivi (Ondelli-Viale 2010: 2), in particolare per quanto concerne il fenomeno dell’‘esplicitazione’ (Baker 1996: 180-185) e la ‘legge dell’interferenza’ (Laviosa-Braithwaite 2001: 290-291). Questa conclusione potrebbe indurre a screditare l’utilità dei corpora paralleli per l’analisi linguistica; tuttavia, riteniamo che proprio i fenomeni di esplicitazione presenti nei testi di arrivo rappresentino spesso la chiave per approfondire la semantica di una determinata struttura linguistica presente nel testo fonte (Noël 2003; Zaliznjak, Denissova, Mikeljan 2018, Šmelev 2020). Un corpus parallelo bidirezionale, inoltre, garantisce la possibilità di un confronto incrociato che arricchisce ulteriormente l’analisi (Johansson 1998).

 

Bibliografia:

Apresjan Ju. D., On the structure of explications. Some illustrations from Russian, in “Journal of Pragmatics North-Holland”, 10, 1986, pp. 535-541

Baker M. Corpus-based translation studies: the challenges that lie ahead, in Somers H. (ed), Terminology, LSP and Translation: Studies in language engineering in honour of Juan C. Sager, John Benjamins Publishing Company, 1996, pp. 175-186.

Baranov A. N., “Predpoloženie” versus “fakt”: “neuželi” versus “razve”, in “Zeitschrift Slawistik”, 1986, 31/1, pp. 119-131.

Biagini F., Bonola A. Descrizione semantico-funzionale delle particelle russe e corpora paralleli. Un’analisi contrastiva (italiano-russo) corpus-based di ved’. Krapova I., Nistratova S., Ruvoletto L. (eds). Studi italiani di linguistica slava: nuove prospettive e metodologie di ricerca. Edizioni Ca’ Foscari, Venezia, 2019, pp. 53-78.

Bonola A., Le particelle come manifestazione del connettivo nella lingua russa, in Gatti M. C., Cigada S., Gobber G. (ed), Syndesmoi. Connettivi nella realtà dei testi, Milano, Vita e Pensiero, 2006, pp. 199-220.

Bonola A., Noseda V., The use of parallel Corpora for a contrastive (Russian-Italian) description of discourse markers: new instruments compared to traditional lexicography, in Atti del IX Convegno Annuale AIUCD. La svolta inevitabile: sfide e prospettive per l’Informatica Umanistica. A cura di: Marras, Cristina; Passarotti, Marco; Franzini, Greta; Litta, Eleonora, Milano: Università Cattolica del Sacro Cuore, 2020, pp. 39-46.

Bulygina Т.V., Šmelev А.D. Dialogičeskie funkcii nekotorych tipov voprositel’nych predloženij, inIzvestija AH CCCP, ser. Literatura i jazyk”, t. 41, 1982, n. 4.

Inkova O.Ju., Principy opredelenija lingvospecifičnosti konnektorov, inKomp’juternaja lingvistika i intellektual’nye technologii”,16(2), 2017, pp. 150–60.

Karoj F., Ešče raz o razve i neuželi, Diss. Slav.: Ling. XXIII. Szeged, 1994, pp. 13-22.

Johansson S. On the role of corpora in cross-linguistic research, in Johansson S., Oksefjell S. (eds.), Corpora and cross-linguistic research: theory, method and case studies. Amsterdam, New York, Rodopi, 1998, pp. 3-24.

Laviosa-Braithwaite S. Universals of translation, in Baker M. (ed.), Routledge encyclopedia of translation studies, London, New York, Routledge, 2001, pp. 288-291.

Noël D. Translations as evidence for semantics: an illustration. Linguistics 41(4), 2003, pp. 757–785.

Ondelli S., Viale M. L’assetto dell’italiano delle traduzioni in un corpus giornalistico. Aspetti qualitativi e quantitativi, in “Rivista internazionale di tecnica della traduzione = International Journal of Translation”, 12, 2010, pp. 1-62.

Rathmayr R., Die Russischen Partikeln als Pragmalexeme, Otto Sagner, München, 1985.

Šmelev A.D. lingvospecifičnye slova v zerkale perevoda: toska. in “Komp’juternaja lingvistika i intellektual’nye technologii”, 19, 2020, pp. 658-669.

Zaliznjak A.A., Denissova G.V., Mikeljan I.L. Russkoe kak-nibud’ po dannym parallel’nych korpusov, in “Komp’juternaja lingvistika i intellektual’nye technologii”, 17, 2018, pp. 803–817.

 

Giorgia Pomarolli - Lingvokul’turologija e Cultural Linguistics: proposta per un confronto

La lingvokul’turologija è una disciplina sorta in contesto russo sul finire degli anni Novanta che, come suggerisce la denominazione stessa, coniuga ricerca linguistica e studi di matrice culturologica, ovvero – avvalendoci della definizione di Valentina Maslova, primo teorico della lingvokul’turologija – «исследу[ет] проявления культуры народа, которые отразились и закрепились в языке» [Маслова 1997: 8]. L’interesse della lingvokul’turologija è rivolto principalmente alla lingua e alla cultura del “popolo russo”, sebbene non sia raro imbattersi in studi d’impianto contrastivo. Ad oggi la lingvokul’turologija rappresenta un frequentatissimo ambito d’indagine, a cui sono dedicati numerosi manuali, articoli scientifici, tesi dottorali e convegni di orientamento linguistico. Inoltre essa costituisce regolare materia di insegnamento nelle facoltà di Filologia e Lingue straniere. Dobbiamo rilevare, però, che il successo della lingvokul’turologija resta circoscritto al solo contesto russo, in ragione del fatto che la lingua di divulgazione della disciplina è, quasi esclusivamente, quella russa. È curioso notare come una corrente di studi che combina linguistica e studi culturali sia andata affermandosi pressoché nello stesso periodo in contesto occidentale: si tratta della cosiddetta cultural linguistics. L’espressione “cultural linguistics” inizia a circolare in ambito statunitense nel corso degli anni Novanta per indicare una disciplina che manifesta «a broad interest in language and culture, a concern with folk knowledge, and a reliance on both ethnographic and linguistic methods» [Palmer 1996: 36]. Nell’arco degli ultimi due decenni la cultural linguistics ha visto la pubblicazione di monografie e miscellanee, la nascita di una rivista specializzata, l’«International Journal of Language and Culture», e l’allestimento di un ciclo di convegni internazionali, il primo dei quali si è svolto a Prato nel 2016. L’esponente più autorevole di tale disciplina è Farzad Sharifian, autore di numerose monografie ed articoli, nonché fondatore e preside della prima cattedra a livello internazionale di cultural linguistics, presso la Monash University (Australia). Oltre all’evidente affinità nella denominazione, entrambe le discipline condividono il medesimo orizzonte teorico, ponendosi in continuità con la “linguistica del carattere” di Wilhelm von Humboldt e l’ipotesi della relatività linguistica formulata da Edward Sapir e Benjamin Whorf. Sia la lingvokul’turologija, sia la cultural linguistics mirano ad investigare il rapporto che intercorre tra la lingua (jazyk-language), la cultura (kul’tura-culture) ed il popolo (narod-folk), impiegando metodi mutuati dalla linguistica, dall’etnografia e dall’antropologia. Entrambe le discipline hanno una vocazione manifestamente interdisciplinare: se la lingvokul’turologija è orientata all’indagine di problemi didattici, traduttivi, lessicologici e di comunicazione interculturale (in russo mežkul’turnaja kommunikacija) ecc. che riguardano fondamentalmente la lingua russa, la cultural linguistics si propone di approfondire questioni di linguistica applicata che includono «intercultural communication, intercultural pragmatics, World Englishes, Teaching Englishes as an International language, and political discourse analysis» [Sharifian 2017b: 2]. Entrambe le discipline muovono dal presupposto fondamentale che la lingua, a tutti i livelli d’analisi – morfologico, lessicale, fraseologico, sintattico, semantico – costituisce una chiave interpretativa per decifrare i fenomeni culturali: «в сфере интереса лингвокультурологии значатся любые языковые единицы, приобретшие символическое значение и отражающие культурную информацию» [Бутенко 2008: 322]; «The main focus of Cultural Linguistics is relied on any method and any data that can give us clues about the relationship of language and cultural conceptualisations» [Sharifian 2016]. Tra le due discipline si registrano, tuttavia, delle differenze sostanziali. La lingvokul’turologija eredita inalterati i principi del determinismo e della relatività linguistica così come si ritrovano nell’ipotesi Sapir-Whorf : «люди, говорящие на разных языках, по-разному воспринимают мир и по-разному мыслят, картина мира зависит не столько от наблюдаемой реальности, сколько от той классификационной сетки, которую конкретный язык с его грамматикой и лексикой навязывает говорящему» [Сабитова 2015: 12]. Tale impostazione porta a presupporre un’identità assoluta tra i membri della comunità linguistica, dal momento che proprio la lingua «заставляет видеть мир, думать и чувствовать именно так, а не иначе» [Зализняк, Левонтина, Шмелев 2012: 11]. In ragione di ciò, gli studi di lingvokul’turologija ambiscono a ricostruire i tratti caratteristici della comunità linguistico-culturale (“carattere nazionale”/“mentalità etnica”) così come troverebbero attestazione nelle strutture linguistiche. Diversamente, gli studi di cultural linguistics propongono una rivisitazione dell’ipotesi della relatività linguistica e ne prendono le distanze su alcuni punti fondamentali: «Cultural Linguistics rejects the simplistic view that it is possible to extract the culture/worldview/thought patterns of a speech community by analysing the features of the language they speak» [Sharifian 2017a: 90]. Il focus d’interesse della cultural linguistics non è tanto il rapporto che intercorre tra una lingua e una cultura data, quanto piuttosto quello tra lingua e “cultural cognition”. Tale nozione allude ad una rete di rimandi culturali condivisi, prodotta e ricorsivamente modificata dall’interazione che si realizza nel tempo e nello spazio tra i parlanti una lingua. Riferendosi a un processo in continuo divenire, la nozione di “cultural cognition” esclude a priori la possibilità di rintracciare, in seno ad una medesima comunità linguistica, una “mentalità etnica” o un “carattere nazionale” fissati. Per questa ragione la cultural linguistics riconosce un gradiente di variabilità irrinunciabile all’interno della comunità linguistico-culturale: «speakers show variation and differences in their access to an internalisation of cultural cognition. Also, cultural cognition is dynamic in that it is constantly being negotiated across generations and through contact with other speech communities» [Sharifian 2017a: 90]. Nonostante questa differenza di principio, è significativo rilevare che lingvokul’turologija e cultural linguistics, pur essendosi sviluppate nel medesimo periodo storico, pur condividendo lo stesso sostrato teorico e pur orientandosi, in fase applicativa, lungo percorsi affini, non intrattengono alcun dialogo e paiono ignorare ciascuna l’esistenza dell’altra.

Liana Goletiani - Деонтический запрет в русском и украинском языках: компаративное описание на материале однотипных и параллельных текстов

Предлагаемый доклад продолжает ряд предыдущих компаративных исследований автора в области выражения деонтической модальности. Объектом описания в этот раз выбраны глагольные конструкции, использующиеся для формулирования запрещающих норм в русском и украинском юридическом языках. Основное внимание будет уделено модальным конструкциям, выражающим негативное обязательство.

В качестве материала исследования используются документы разных жанров - как однотипные нормативные тексты, относящиеся к законодательству РФ и Украины, так и параллельные тексты, представляющие собой переводы права Европейского Парламента и Совета. В последнем случае английские конструкции оригинальной версии будут рассматриваться как tertium comparationis, что позволит уточнить и соотнести значения украинских и русских модальных показателей, использованных в качестве переводческих соответствий.

Основной целью исследования является выявление аналогий и различий двух языков в области выражения нормативного запрета, поэтому на первом этапе устанавливается полная - с точки зрения лексических средств выражения негативного обязательства - типология глагольных конструкций. Будут установлены лексические соответствия между двумя славянскими языками для однотипных нормативных документов. Показывается, что в семантике всех этих средств присутствует значение отрицания.

На втором этапе исследование фокусируется только на тех запрещающих нормах, которые выражены отрицательными предложениями, содержащими в качестве маркеров деонтического запрета модальные показатели (не должен… / не повинен… и др.). Методология сопоставления основывается на изоморфизме, с одной стороны, типов нормы и категорий модальной логики (запрет как отсутствие деонтической возможности) и соотнесенности семантических значений модальных показателей с модально-логическими категориями – с другой (напр., не может = отсутствие деонтической возможности).

На многочисленных примерах показывается, что запреты в отличие от обязательств (деонтическая необходимость) и разрешений (деонтическая возможность), в украинском и русском юридическом языках могут кодироваться с помощью модальных показателей обоих типов – как возможности, так и необходимости – в сочетании с одним или более показателем отрицания. Обнаружено, что вариативность украинских модальных конструкций при этом несколько выше русских – как за счет большего числа показателей необходимости, так и за счет большего разнообразия морфологических категорий глагола. Тем не менее в запрещающих нормах она не так высока, как в случае с обязательствами.

Третья часть исследования фокусируется на проблеме позиционного взаимодействия отрицания с показателем  обязательства (не должен / должен vs. не обязан / обязан не). Отмечается релевантность данной проблемы и для части украинских модальных показателей, что в некоторых контекстах может вызывать трудности интерпретации у коммуникаторов– неэкспертов.

Кроме того, приводятся статистические данные для наиболее продуктивных модальных показателей и конструкций с ними в обоих языках. Делается вывод о необходимости дифференцированного сопоставления модальных конструкций в зависимости от жанра нормативного источника. Результаты исследования могут быть использованы как для уточнения типологической близости двух языков, так и в прикладных целях – при создании специальных словарей, переводе международной документации, дидактике специальных языков.

 

Литература

Besters-Dilger, Juliane, Ana Drobnjaković and Björn Hansen (2009): Modals in the Slavonic languages. In:  Modals in the Languages of Europe: A Reference Work, ed. Hansen, Bjornand Ferdinand de Haan, 167-197. Berlin/New York: Mouton de Gruyter.

Biel, Ł. 2014. The textual fit of translated EU law: a corpus-based study of deontic modality. In: The Translator 20 (3), 332-355.

Coppolella, Mariangela (2014): Modal Values of Verbal Forms in the European Chapter for Regional or Minority Languages. A Linguistic Comparative Analysis of the English, Italian and Spanish Versions. Comparative Legilinguistics 18: 25-48.

Coates, Jennifer (1983): The Semantics of the Modal Auxiliaries. London: Croom.

De Haan, Ferdinand (1997): The Interaction of Modality and Negation. A Typological Study. New York & London : Garland.

Goletiani, Liana (2015): Zur Übersetzung deontischer Modalmarker ins Ukrainische: eine korpusgestützte Untersuchung anhand von EU-Richtilinien. In: Zeitschrift für Slawistik 60 (2), 269-293.

Goletiani, Liana (2019): Trasformazione di diatesi nella traduzione di testi legali in ucraino e russo: evidenze dall’analisi contrastiva. In: Eurasiatica 14, 151-164.

Rytel, D. 1982. Leksykalne środki wyrażania modalności w języku czeskim i polskim. Wrocław: Zakład Narodowy im. Ossolińskich. Wydawnictwo Polskiej Akademii Nauk.

Van der Auwera, Johan and Plungian, Vladimir (1998): Modality’s Semantic Map. Linguistic Typology 2, 79-124.

Von Wright, H. (1951): An Essay in Modal Logic. Amsterdam: North-Holland.

Голетиани, Лиана (2016): Выражение деонтической модальности  ‘обязательство’: русские и украинские глагольные конструкции. Comparative Legilinguistics 26, 7-30.

Мечковская, Н.Б.  2000. Законы об авторских правах: модальные операторы в диагностике коллизий и тенденций развития. В: Н.Д. Арутюнова, Т.Н. Янко, Н.К.Рябцева (отв. ред.) Логический анализ языка. Языки этики. Москва: Языки русской культуры, 293-305.

Озерова Н.Г. (1978): Средства выражения отрицания в русском и украинском языках. Киев: Наукова думка.

Падучева, E.B. (2013): Русское отрицательное предложение. Москва: Языки славянской культур.

 

Erica Pinelli - Metafore e metonimie multimodali nei manifesti contro l’alcolismo

In Russia l’alcolismo è sempre stato un grave problema sociale e nel periodo sovietico alcune campagne antialcoliche sono state promosse nel tentativo di arginarlo. La campagna antialcolica più importante è stata quella condotta da Michail Gorbačëv nel 1985. Le misure antialcoliche rigide e impopolari di Gorbačëv sono state sostenute da una massiccia campagna propagandistica nella quale ha avuto un ruolo centrale un particolare tipo di manifesto sociale, l’ antialkogol’nyj plakat (cf. Buvina 2014).

Essendo caratterizzato dall’unione di immagine e testo, il plakat è estramente utile per l’analisi multimodale. In questo studio vengono analizzati alcuni plakaty contro l’alcolismo pubblicati in Russia (RSFSR) tra il 1985 e il 1988 e vengono messi in evidenza i processi metaforici e metonimici utilizzati nei manifesti a fini persuasivi. In particolare, l’analisi si concentra sull’interazione tra metafora e metonimia in due diverse modalità, verbale e pittorica.

La metafora multimodale è definita da Forceville (2009:24) come una metafora “il cui dominio di partenza e quello di arrivo sono rappresentati esclusivamente o prelaventemente in modalità diverse”. Allo stesso modo, la metonimia multimodale è definita come “una mappatura che permette di accedere ad un concetto richiamandone un altro all’interno dello stesso dominio in un processo che implica un passaggio di modalità” (Pérez-Sobrino 2017:97).

Vista la difficoltà nell’identificazione del dominio di partenza e di arrivo, molti studi sulla multimodalità si sono concentrati sulla pubblicità commerciale perché, avendo uno scopo ben definito, permette di individuare i due domini senza ambiguità. Infatti, l’obiettivo della pubblicità commerciale è chiaramente quello di promuovere un certo prodotto presentandone le caratteristiche positive e creando, quindi, associazioni positive (Forceville 1996). A differenza delle campagne pubblicitarie commerciali, il manifesto sociale non promuove un prodotto ma un’idea o un comportamento. In particolare, le campagne antialcoliche hanno lo scopo di dissuadere dall’uso di alcol e quindi nei plakaty antialcolici non vengono mappate le caratteristiche positive, ma quelle negative dell’alcol, creando così inferenze negative.

Nella comunicazione multimodale la metonimia sembra avere un ruolo centrale. In particolare nelle pubblicità sociali che non promuovono un prodotto concreto ma qualcosa di astratto, la rilevanza della metonimia è ancor più evidente: è infatti necessario un elemento pittorico concreto che permetta metonimicamente l’accesso al concetto target astratto (Bolognesi 2019). Per quanto riguarda i manifesti antialcolici, non solo sovietici (cf. Veinberga 2014), l’elemento pittorico centrale è la bottiglia (o, più raramente, il bicchiere) la quale innesca un processo metonimico: la bottiglia sta per la bevanda alcolica che, a sua volta, permette l’accesso al concetto di abuso di alcol.

Come in altre campagne pubblicitarie legate a temi della salute (cf. Herrero 2006; Serrano-Losada 2015), anche nei manifesti antialcolici la metonimia causa-effetto è fondamentale. I temi utilizzati nei manifesti per dissuadere dall’abuso di alcol sono diversi: l’abbandono famigliare, la salute e il rischio di lesioni fisiche, la bassa produttività lavorativa, la criminalità, etc.

In molti casi, le metonimie multimodali interagiscono con altre metonimie o con altri complessi metaforici. Vari studi hanno evidenziato che la multimodalità permette interazioni tra metafora e metonimia ancora più complesse rispetto a quelle possibili in modalità esclusivamente verbale (Pérez-Sobrino 2017; Forceville/Urios-Aparisi 2009).

Analizzando la funzione della bottiglia pittorica, i manifesti antialcolici degli anni Ottanta mostrano una particolarità: la bottiglia interagisce pittoricamente con le parti del corpo umano. Per questo motivo per l’analisi mi sono concentrata su nove manifesti antialcolici in cui la bottiglia, che metonimicamente introduce il tema dell’alcolismo, interagisce con alcune parti del corpo umano: la gamba, la mano e la testa. Ogni parte del corpo rimanda metonimicamente ad una funzione o abilità dell’uomo ma, in alcuni casi, è inserita in un complesso metaforico più ampio.

Oltre ad analizzare il ruolo della bottiglia metonimica e individuare eventuali caratteristiche ricorrenti, il presente lavoro mira a esaminare come gli elementi pittorici interagiscono con quelli verbali all’interno del manifesto. Gli studi sulla multimodalità hanno confermato il ruolo dell’elemento verbale come “ancoraggio” che “limita il potere proiettivo dell’mmagine” (Barthes 1997: 39) e che segnala e permette di restringere possibili interpretazioni dell’elemento visivo (Koller 2009: 47); in altri casi, invece, l’elemento verbale facilita l’attivazione dei processi cognitivi (Yus 2009:157). Analizzando i manifesti shock del WWF sulla protezione dell’ambiente, Pérez-Sobrino (2016: 286) osserva che, se le metafore sono rese principalmente nella modalità visiva, le metonimie sono di solito limitate dal testo, ovvero l’elemento verbale segnala la necessità di un aggiustamento concettuale tra lo scenario visivo e il messaggio pubblicitario e determina inoltre la natura e la misura della mappatura metonimica.

L’analisi mostra che la funzione dell’elemento verbale nell’interpretazione dell’immagine varia in base alla complessità degli elementi messi in gioco nel manifesto. In alcuni casi l’elemento verbale riprende ed esplicita ciò che già è comunicato attraverso l’immagine rendendo il manifesto immediato e inequivocabile; in altri casi, invece, l’elemento verbale innesca nuovi processi cognitivi e nuove interpretazioni, a volte anche ironiche.

 

Bolognesi Marianna. 2019. “Il linguaggio figurato nella comunicazione multimodale. Il genere pubblicitario e la campagna sociale”. In RICOGNIZIONI, 6, 11-28.

Buvina Elena. 2014. “Il fascino e la maledizione dell'alcol nella stampa popolare russa”. In Quaderni di Palazzo Serra, 25, 59-98.

Forceville Charles J. 1996. Pictorial metaphor in advertising. London/New York: Routledge.

Forceville Charles J., Urios-Aparisi Eduardo (eds.). 2009. Multimodal Metaphor, Berlin/New York, Mouton de Gruyter

Herrero Javier. 2006. “The role of Metaphor, Metonymy, and Conceptual Blending in Understanding Advertisements: The case of drug-prevention Ads. In Revista Alicantina de Estudios Ingleses, 19, 169-190.

Koller Veronika. 2009. “Brand images: Multimodal metaphor in corporate branding messages”. In Forceville Charles J., Urios-Aparisi Eduardo (eds.), 45-72.

Pérez Sobrino Paula. 2017. Multimodal Metaphor and Metonymy in Advertising. John Benjamins Publishing Company.

Serrano-Losada Mario. 2015. Multimodal metaphorical and metonymic renderings of pain in advertising: a case study. In Revista Electrónica de Lingüística Aplicada, 1/14, 35-50.

Veinberga Elina. 2014. “Multimodal Metonymic Image of the Bottle in Advertising. Language in Different Contexts”. Research papers Vol VI (1), Part 1. Vilnius: Lietuvos edukologijos universiteto leidykla, p. 182-190.

Yus  Francisco. 2009. “Visual metaphor versus verbal metaphor: A unified account”. In Forceville Charles J., Urios-Aparisi Eduardo (eds.), 147-172.

 

Anna Maria Perissutti - Il ruolo dei verbi stativi nelle costruzioni media e mediopassiva in ceco

La ricerca esplora il ruolo dei verbi stativi all’interno della costruzione  media e  della variante mediopassivain ceco, di cui agli esempi (1) e (2):

(1) Šlo                                            se               mi                    snadno.

Andare-PST-IPFV-3SG-N          SE            me-DAT             facilmente

‘Camminavo con facilità’.

(2) Tahle košile                       se             mi / Karlovi                            dobře  žehlí.

Questa camicia-NOM-F        SE            me-DAT / Karel-DAT            bene         stirare- PRS-IPFV-3.SG

‘Per me/ per Karel è facile stirare questa camicia.’

Si tratta di una costruzione tipica delle lingue slave che  ha ricevuto diverse denominazioni nelle pubblicazioni di linguistica slava: ‘modale deagentiva’ (Geniušiené 1987: 273), ‘media’ (Panevová & Karlík 2018), ‘dispositional reflexive’ (Fried 2005), ‘involontary state’ (Rivero & Arregas 2012) e altre.

La variante media di questa costruzione (esempio 1) è caratterizzata dalla presenza del morfema riflessivo clitico se, dal verbo intransitivo, tipicamente inergativo, dall’espressione dell’agente al caso dativo, dall’assenza di accordo nel verbo, che appare alla terza persona del genere neutro, e dalla presenza obbligatoria dell’avverbio di valutazione.

La cosiddetta variante mediopassiva (esempio 2) mostra contemporaneamente tratti sintattici tipici del passivo (il complemento oggetto al nominativo) accanto a tratti morfologici, sintattici e semantici tipici del medio, quali la morfologia attiva del verbo, il pronome riflessivo e l’espressione dell’agente al dativo.

L’interpretazione sintattica di queste due costruzioni, in cui l’agente è espresso al dativo, sembra contraddire la caratterizzazione del medio (si veda ad esempio Cinque 1988) come struttura in cui il ruolo esterno soppresso non può essere riassegnato da nessun altro elemento. Medová (2009) e Rivero & Arregas (2012) interpretano questa costruzione come un evento complesso, risultato di composizione semantica e sintattica; l’agente al dativo sarebbe introdotto, secondo gli autori, da un sintagma applicativo  (secondo il modello descritto da Pylkkänen 2002).

Sempre Rivero & Arregas (2012)  mettono in evidenza il  significato fattuale delle due costruzioni in ceco, in contrasto con quello desiderativo delle analoghe costruzioni nelle lingue slave meridionali, e ritengono che esse diano vita a un evento di stato involontario.

L’analisi più completa delle due costruzioni in ceco si trova in Fried (2005), che affronta la ricerca in chiave costruzionista (Croft 2001), analizzando i singoli componenti della costruzione, per definirne i tratti semantici, pragmatici e morfosintattici. L’autrice si sofferma sull’aspetto verbale dei verbi che entrano nelle costruzioni in oggetto, aspetto che è rigorosamente imperfettivo, almeno per la costruzione mediopassiva. Sostiene che questa restrizione è coerente con la funzione comunicativa della costruzione, consistente nell’esprimere una generale attitudine o disposizione dell’esperiente nei confronti dell’azione o del processo espresso dal verbo. Secondo l’autrice le due costruzioni sono incompatibili con i verbi di stato:

“This construction is incompatible with stative verbs (milovat ‘to love’, vidět ‘see’ or slyšet ‘hear’, být ‘be’, etc.), which follows from its function: recasting as an experience what is inherently an action or a process dependent on the intentional involvement of a human participant”. (Fried 2005: 22)

La nostra ricerca parte proprio da questa osservazione della Fried: dalla nostra analisi dei dati estratti dal corpus Sketch Engine Czech Ten Ten 2017 è emerso invece che le costruzioni in oggetto sono compatibili con alcuni verbi di stato (ležet ‘stare disteso’, stát ‘stare in piedi’, být ‘essere’, sedět ‘stare seduto’, žít ‘vivere’ e altri), mentre risultano escluse con altri (tra questi ultimi troviamo i verbi di percezione sensoriale slyšet ‘sentire’, vidět ‘vedere’ e molti altri).

Per spiegare la distribuzione evidenziata dai nostri dati, utilizzeremo l’illuminante distinzione evidenziata da Maienborn (2007) e Rothmayr (2009) tra predicati stativi che denotano entità collocate nello spazio (Davidsonian state predicates) e predicati stativi che denotano entità astratte, non collocate nello spazio (Kimian state predicates). Vedremo come uno degli elementi presenti nelle costruzioni in oggetto sia proprio il riferimento alle circostanze spaziali in cui l’evento si realizza.

I risultati della ricerca getteranno luce sull’importanza di considerare nelle analisi sintattiche le informazioni provenienti dal lessico.

 

Bibliografia:

Cinque, Guglielmo. 1988. “On Si Construction and the Theory of Arb”. Linguistic Inquiry 19(4): 521–581.

Croft, William. 2001. Radical Construction Grammar. Syntactic theory in typological perspective. Oxford: Oxford University Press.

Fried, Mirjam. 2005. “Constructing grammatical meaning: isomorphism and polysemy in Czech reflexivization”. University of Pennsylvania Working Papers in Linguistics 7: 97-110. Studies in Language 16–3: 475–512.

Janda, Laura A. 1993. “The semantics of Russian and Czech reflexives”. In R. Maguire & A. Timberlake (eds.), American Contributions to the EleventhInternational Congress of Slavists, Bratislava, 310-319. Slavica.

Kemmer, Susanne. 1993. Middle voice. Amsterdam & Philadelphia: John Benjamins.

Kopečný, František. 1954. Pasívum, reflexívní forma slovesná reflexívní sloveso. Studie a práce lingvistické. Praha: Academia.

Geniušienė, Emma. 1987. The typology of reflexives. Mouton de Gruyter.

Grepl, Miroslav & Petr Karlík. 1998. Skladba spisovné češtiny. Praha: Votobia.

Maienborn, Claudia. 2007. On Davidsonian and Kimian States. In: I. Comorovski & K. von Heusinger (eds.). Existence: Syntax and Semantics. Dordrecht: Kluwer, 107-130.

Medová, Lucie. 2009. Reflexive Clitics in the Slavic and Romance Languages. A Comparative View from an Antipassive Perspective. PhD. Dissertation, Princeton University.

Panevová & Karlík. 2018. Reflexivní Sloveso. In P. Karlík – M. Nekula – J. Pleskalová. Nový Encyklopedický Slovník.  https://www.czechency.org/slovnik/REFLEXIVN%C3%8D%20SLOVESO

Pylkkänen, Liina. 2002. Introducing Arguments. Ph.D. thesis. Cambridge, MA: MIT Press.

Pustejovsky, James. 1995. The Generative Lexicon. Cambridge, MA: MIT Press.

Rothmayr, Antonia. 2009. The Structure of Stative Verbs. Amsterdam: John Benjamins Publishing Company.

Rivero, María Luisa & Arregui, Ana. 2012. “Building Involuntary States in Slavic”. In V. Demonte & L. McNally (eds.), Telicity, Change and State. A Cross-categorial View of Event Structure. Oxford: Oxford University Press, 300-332.

Ettore Gherbezza - Sulla discontinuità linguistica dei prestiti. Il caso degli italianismi in russo

L’indagine si propone di illustrare quali tipi di discontinuità linguistica si possono osservare a livello morfologico prendendo in esame i numerosi prestiti lessicali italiani che sono stati accolti in russo. I casi di trasmissione discontinua possono riguardare tanto la categoria di appartenenza di una singola voce, quanto alcuni suoi tratti specifici (per es. genere o numero dei sostantivi).

I cambi di categoria sono piuttosto rari, per individuarne alcuni dobbiamo uscire dal perimetro della lingua standard: nella lingua speciale della musica, per es., la replica арпеджио/арпеджо a differenza del modello italiano arpeggio rappresenta sia un sostantivo (n. inv.), sia un avverbio che significa ‘in arpeggio’ (TSIS: этоместоисполняетсяарпеджио). Oppure, per rimanere nel campo della musica, la locuzione avverbiale italiana da capoviene replicata – per agglutinazione – con la parola composta да-капо, sostantivo (n. inv.) che designa la ‘didascalia con cui si prescrive la ripetizione di un brano musicale’.

Ben più feconda risulta l’osservazione dei mutamenti che interessando il numero e soprattutto il genere dei sostantivi nel processo di mutuazione. Detto che risultano praticamente assenti i casi in cui un vocabolo italiano entra in russo con la sua flessione (gli unici esempi sono rappresentati dalle coppie di sostantivi лаццолацци e бравобрави, cf. NSIS), va subito aggiunto che nella maggior parte dei casi viene replicato un modello al singolare, e che esso viene adattato alle strutture morfologiche della lingua russa e viene contestualmente assegnato alla categoria del genere essenzialmente sulla base di tre ordini di fattori (Marinova 2012b: 317): quello genetico (influsso del genere che il prototipo aveva nella lingua-modello), quello morfologico o strutturale (ruolo preponderante della terminazione del prototipo) e quello paradigmatico (influsso del genere dell’iperonimo o del sostantivo semanticamente affine nella lingua-replica). Accanto a queste considerazioni, in ottica diacronica non va dimenticato il ruolo svolto dalla (o dalle) lingue di mediazione che si sono interposte nel passaggio dall’italiano al russo, che spesso si è rivelato determinante anche per l’assegnazione del genere (basti pensare a parole come фронтон e парапет, mutuate per il tramite del francese e allineate al genere maschile: cf. DIR e Gherbezza 2012: 127).

Merita soffermarsi in particolare sull’attribuzione del genere ai sostantivi-replica che terminano con una vocale diversa da -а, che presentano un livello molto basso di integrazione e rimangono fuori dal sistema flessivo del russo. I sostantivi che rimandano a un denotato animato seguono il criterio semantico, con la tendenza a conservare il genere grammaticale corrispondente a quello naturale, indipendentemente dalla terminazione del modello (ad es. le voci † чичероне, импресарио, папарацци sono registrate come sostantivi maschili – per папарацци è più corretto parlare di genere comune –, mentre sono femminili контральто e меццо-сопраноquando designano la cantante dotata della rispettiva voce; cf. TSIS), invece per i sostantivi che rimandano a un denotato non animato il quadro si presenta assai più variegato: la regola prevede che essi vengano associati al genere neutro, vero e proprio “deposito per le parole straniere che presentano caratteristiche fonetiche e morfologiche atipiche per i sostantivi russi” (Vinogradov 1972: 76); tuttavia le deviazioni da questa regola non mancano, e la loro incidenza cresce in maniera significativa per le acquisizioni più recenti, di epoca post-sovietica (in linea con quanto rilevato da Marinova 2012a: 142 e ss., Marinova 2012 b: 320 e ss.); tali deviazioni sono spiegabili con uno spostamento del parametro di riferimento dal livello morfologico-strutturale a quello paradigmatico. Tra gli italianismi in russo troviamo quindi sostantivi di genere neutro come авизо, гетто, жиро,инкассо, либретто, фиаско (TSIS, BAS3), che sono stati assimilati sulla base del parametro morfologico, anche in virtù della capacità di attrazione dei sostantivi russi della prima declinazione in -o. Tuttavia per un sostantivo come ризотто, che si è diffuso in maniera significativa solo in epoca post-sovietica, viene da chiedersi se non abbia funzionato piuttosto il criterio paradigmatico, ovvero l’influsso del sostantivo russo блюдо (in analogia con quanto accade, per es., per il prestito спагетти, registrato come plurale nell’accezione ‘tipo di pasta alimentare’, e come neutro nell’accezione ‘porzione, piatto di pastasciutta preparato con questo tipo di pasta’; cf. TSIS, DIR). Sicuramente in virtù del criterio paradigmatico sono stati assegnati al genere femminile i sostantivi брокколи (per influsso dell’iperonimo russo капуста), салями (iperonimo: колбаса), бриндизи (nell’accezione di ‘brano di opera lirica’; iperonimo: песня), mentre è stato assegnato al genere maschile цукини (iperonimo: кабачок).

Da questo rispetto la situazione attuale mostra una certa instabilità, tanto che non mancano i casi in cui uno stesso prestito (qui: italianismo) viene associato a più di un genere, a seconda del criterio seguito: per es. капучино, мартиниe тирамису oscillano tra il genere neutro, attribuibile in base alla regola generale e al parametro morfologico, e il maschile a cui vengono accostati per attrazione dei sostantivi russi semanticamente affini вермут, кофе e десерт (ROS). È emblematico il caso del sostantivo биеннале (variante: бьеннале), che è stato associato a tutti e tre i generi a seconda del criterio usato e della parola russa a cui è stato avvicinato (выставка o фестиваль; cf. Marinova 2016: 125).

Tenendo ferma la prospettiva morfologica, ma guardando in diacronia, meritano attenzione anche alcune parole che oggi vengono registrate dalla lessicografia russa come interiezioni, e che altro non sono (o non erano) se non dei comandi, derivati da imperativi veneziani in -a (categoria a cui dedica un accenno Migliorini 1957: 8) come майна (infinito veneziano: mainar) e вира (infinito veneziano: virar), usate nell’ordine per far abbassare e alzare un carico tramite un argano o un verricello e che conobbero ampia diffusione mediterranea attraverso la lingua della marineria; oppure derivati da un’espressione perentoria (con ogni probabilità sempre di origine veneziana) come фора, esclamazione di ambito teatrale con cui il pubblico al termine di uno spettacolo reclamava gli artisti nuovamente sulla scena.

Già da questi pochi esempi si può apprezzare come mettendo a fuoco il tema della discontinuità linguistica sia possibile gettare luce sia sui modelli che stanno all’origine di un prestito, sia, soprattutto, sulle repliche e dunque sulla relazione che le lega al sistema morfologico della lingua russa.

 

BIBLIOGRAFIA ESSENZIALE

Gherbezza 2012 = E. Gherbezza, Per lo studio degli italianismi nella lingua russa, «Russica Romana», XIX, pp. 117-132.

Gusmani 1986 = R. Gusmani, Saggi sull’interferenza linguistica, II ed. accresciuta, Firenze, Le Lettere.

Marinova 2012a = E.V. Marinova, Inojazyčnye slova v sovremennoj russkoj reči, Saarbrücken, Lap Lambert.

Marinova 2012b = E.V. Marinova, Var’irovanie roda novych inojazyčnych slov i problema normy, «Acta Linguistica Petropolitana. Trudy Instituta lingvističeskich issledovanij RAN», VIII, 3, pp. 315-324.

Marinova 2016 = E.V. Marinova, Novye nesklonjaemye suščestvitel’nye v ich otnošenii k grammatičeskoj kategorii roda, in Neologija i neografija: sovremennoe sostojanie i perspektivy. K 50-letiju naučnogo napravlenija, otv. red. T.N. Buceva, Sankt-Peterburg, Nestor-Istorija, pp. 125-129.

Migliorini 1957 = B. Migliorini, Discontinuità linguistica e prestito morfologico, in Id., Saggi linguistici, Firenze, Le Monnier, pp. 1-10.

Nečaeva 2012 = I.V. Nečaeva, Jazykovye izmenenija i principy orfografičeskogo normirovanija (na materiale inojazyčnych neologizmov), «Acta Linguistica Petropolitana. Trudy Instituta lingvističeskich issledovanij RAN», VIII, 3, pp. 325-336.

Vinogradov 1972 = V.V. Vinogradov, Russkij jazyk. Grammatičeskoe učenie o slove, 2-oe izd., Moskva, Vysšaja škola.

 

DIZIONARI

BAS3 = Bol’šoj akademičeskij slovar’ russkogo jazyka, v 30 tt., gl. red. K.S. Gorbačevič, naučn. koordinator izd. A.S. Gerd, Moskva–Sankt-Peterburg, Nauka, 2004-.

DIFIT = Dizionario di italianismi in francese, inglese, tedesco, a cura di H. Stammerjohann et al., Firenze, Accademia della Crusca, 2008.

DIR = E. Gherbezza, Dizionario di italianismi in russo, Milano, Biblioteca Ambrosiana – Centro Ambrosiano, 2019.

NSIS = E.N. Zacharenko, L.N. Komarova, I.V. Nečaeva, Novyj slovar’ inostrannych slov, 3-e izd., ispr. i dopoln., Moskva, Azbukovnik, 2008.

NSZ-90 = Novye slova i značenija. Slovar’-spravočnik po materialam pressy i literatury 90-ch godov XX veka (v 3 tt.), pod red. T.N. Bucevoj, E.A. Levašova, Sankt-Peterburg, Bulanin, 2009-2014.

ROS = Russkij orfografičeskij slovar’ Rossijskoj akademii nauk, 4-e izd., ispravl. i dopoln., 2012, versione online: <http://orfo.ruslang.ru>.

TSIS = L.P. Krysin, Tolkovyj slovar’ inojazyčnych slov, Moskva, Ėksmo, 2007.

 

Marina Castagneto & Marina di Filippo - I colori in russo: questioni di sfumature

Questo lavoro intende verificare su base sperimentale la percezione e la categorizzazione dei colori non prototipici in russo attraverso un’indagine sperimentale condotta su circa 40 parlanti.

Fase 1. Ai parlanti sono state mostrate immagini di oggetti potenzialmente rappresentativi di uno dei termine di colore non focale (es. un tipo di muffa, o un pulcino) chiedendo di indicarne il colore. Con riferimento alla classificazione di Rich (1977), gli informanti hanno spesso risposto usando termini “qualified basic” (come bledno-žëltyj, in cui l’aggettivo bledno- indica come al colore sia frammisto una maggiore quantità di bianco o come svetlo-zelënyj, in cuila chiarezza denotata da svetlo rimanda a una percezione di maggiore luminosità) o una variazione nella saturazione del colore (es. il modificatore jarko- rimanda ad un colore vivido, saturo, mentre grjazno- indica un colore cui è frammista una forte percentuale di grigio). Altrimenti gli informanti hanno indicato colori “fancy”, cioè termini che fanno riferimento a specifici denotata extralinguistici (es. solomennyj, brusničnyj), o termini “qualified fancy” (es. nebesno-goluboj). Più raramente hanno selezionato composti (es. sero-zelënyj) o derivati, soprattutto in -(ov)at (es. želtovatyj).

Fase 2. Ai parlanti è stato chiesto di individuare sulla Tabella Munsell innanzi tutto il punto focale dei colori di base. In un secondo momento è stato chiesto se riconoscessero altri colori, per verificare se un supporto più astratto favorisca la selezione di termini “qualified basic”, di composti e di derivati, cioè di termini più astratti formati morfo-sintatticamente tramite aggiunta di suffissi o lessemi che apportano una significazione riconoscibile e costante ai termini basici, sfavorendo invece i termini “fancy”, più referenziali e meno grammaticali. É stata verificata anche l’ipotesi di Nowacszyk (1982) per cui le donne sarebbero più inclini degli uomini a selezionare anche in questa parte del protocollo termini di colore “fancy” ormai acclimatati nel lessico (es. korallovyj), che vengono trattati come categoriali.

 

Bibliografia di riferimento

Berlin , Brent & Kay, Paul (1969), Basic color terms: their universality and avolution, Berkeley, University of California Press.

Corbett, Greville, Morgan, Gerry (1988), “Russian color term salience”, Russian Linguistics 13/2, 125-141.

Kay, Paul, & Maffi, Luisa (1999), “Color appearance and the emergence and evolution of basic color lexicons”, American Anthropologist 101, 743-760.

Kreisberg, Alina (2001), Le storie colorate, Pescara, Edizioni Tracce.

Nowaczyk, Ronald H. (1982), “Sex-related differences in the color lexicon”, Language and Speech 25/3, 257-265.

Paramei, Galina, Griber, Yulia, Mylonas, Dimitris (2017), “An online color naming experiment in Russian using Munsell color samples”, Color Research and Application 1-17.

Rich, Elaine (1977), “Sex-related differences in colour vocabulary”, Language and Speech 20/4, 404-409.

Vasilevič A.P., Kuznecova S.N., Miščenko S.S. (2005) Cvet i nazvanija v russkom jazyke, KomKniga, M.

 

Marco Magnani - L’ammissibilità delle “relative di ripresa” in russo: analisi all’interfaccia tra sintassi e semantica

È noto che in russo le frasi relative introdotte da čto al posto di kotoryj sono ammissibili solo in contesti restrittivi. Tuttavia, il recente studio di Milani (2019) mostra che l’agrammaticalità delle relative appositive introdotte da čto si riduce se sono seguite da un pronome di ripresa. Nella presente relazione intendo spiegare questo dato combinando l’analisi semantica di Lyutikova (2016) con la Matching Analysis sintattica (Salzmann 2017). Propongo che (i) le relative appositive richiedano una proforma anaforica con contenuto referenziale indipendente dalla testa (Lyutikova 2016), e (ii) tale scarto referenziale sia da ricondurre alla co-referenza del pronome con la testa interna e alla successiva cancellazione di quest’ultima in forma fonetica (Matching Analysis). Infine confronto il dato russo con alcuni dialetti e lingue minoritarie del Nord Italia che ammettono relative di ripresa solo in contesti appositivi.

 

Riferimenti

Lyutikova, Ekaterina (2016). Syntaksis appositivnyx otnositel’nyx predloženii. Rhema 2: 67-87.

Milani, Sara (2019). Relativizzazione e restrittività: alcuni criteri distintivi in russo. In I. Krapova, S. Nistratova e L. Ruvoletto (a cura di), Studi di linguistica slava: nuove prospettive e metodologie di ricerca, 312-326.

Salzmann, Martin (2017). Reconstruction and Resumption in Indirect A'-dependencies. On the Syntax of Prolepsis and Relativization in (Swiss) German and beyond. Berlin/Boston: De Gruyter Mouton.

Iliyana Krapova - Predicati fattivi nelle lingue slave meridionali e balcaniche tra semantica e sintassi

I predicati fattivi mostrano una serie di contrasti rispetto alle loro controparti non fattive, sia nelle lingue slave che in altre famiglie linguistiche. A livello interpretativo, con verbi fattivi come ‘rimpiangere’ o ‘sapere’ il parlante presuppone la verità del loro complemento, mentre con verbi non fattivi, come ‘pensare’ o ‘dire’, il parlante non introduce tali letture presupposizionali.

Un'area sintattica in cui si manifestano nello slavo speciali caratteristiche distintive (in particolare nelle lingue slave meridionali come il bulgaro o BCMS) riguarda la selezione del complementatore: in queste lingue i predicati fattivi selezionano un complementatore fattivo speciale, diverso dai complementari dichiarativi selezionati dai verbi non fattivi.

Una delle controversie nella più ampia letteratura sulla fattività ha a che fare con la questione di quale gruppo di predicati può essere considerato come il vero rappresentante della classe dei verbi fattivi, in contrapposizione ai non fattivi o semi-fattivi.

I dati dello slavo meridionale e delle altre lingue balcaniche (soprattutto il greco moderno) che saranno discussi in questa presentazione ci aiutano a gettare nuova luce su questa questione.

 

Petra Macurová - Le modalità valutative dell’evocazione di eventi futuri in ceco e in italiano

Partendo da un corpus parallelo di testi letterari cechi e italiani è stata iniziata una ricerca il cui obiettivo è di caratterizzare le peculiarità dei predicati valutativi in ceco in confronto con l’italiano. In questo contributo l’A. si propone analizzare il loro uso nella valutazione soggettiva di eventi futuri, in particolare nei casi che pongono delle difficoltà di traduzione dal ceco all’italiano, come per il verbo těšit se in vari contesti sintattici: (a) těším se na jaro / non vedo l’ora che arrivi la primavera; (b) těšili se (, že pojedou) do Francie / erano contenti di andare in Francia; (c) kolik týdnů se těšil, až si odpočine / quante settimane desiderava di riposarsi; (d) těším se na vaše názory / sono ansioso di sentire le vostre opinioni; (e) ahoj, těším se / ciao, a dopo. Lo studio presenta un’analisi sintattica e pragmatica, sia dei predicati valutativi che delle forme usate per indicare gli eventi futuri, e si propone stabilire una gerarchia degli equivalenti cechi e italiani.

Bibliografia

Grepl, M. (2017). “Evaluační predikátor”. In: Karlík, P. – Nekula, M. – Pleskalová, J. (eds.), CzechEncy – Nový encyklopedický slovník češtiny.

URL: www.czechency.org/slovnik/EVALUAČNÍ PREDIKÁTOR

Grepl, M. (2017). “Evaluační postoj”. In: Karlík, P. – Nekula, M. – Pleskalová, J. (eds.), CzechEncy – Nový encyklopedický slovník češtiny.

URL: www.czechency.org/slovnik/EVALUAČNÍ POSTOJ

Grepl., M. – Karlík, P. (1989). Skladba češtiny. Votobia, Olomouc.

Kerbrat-Orecchioni, C. (2009). L’énonciation: De la subjectivité dans le langage. Armand Colin, Paris.

Konvalinková, R. (1998). “Úvaha o hodnocení jako jevu lingvistickém”. SPFFBU A 46, p. 69–75.

Agnieszka Latos - Il genere grammaticale e il genere naturale

Negli studi precedenti (es. Corbett 1991, Hellinger, Bousmann (eds.), 2001, 2002, 2003) la categoria grammaticale, di natura puramente formale, e la tendenza a codificare nella lingua l’informazione sul sesso del referente animato, seppur teoricamente differenziate, tendono a fondersi l’una con l’altra in un complesso quadro di interconnessioni semantico-formali, spesso incongrue, il cui il comune denominatore è il termine inglese polisemico gender. Lo scopo del presente lavoro è quello di problematizzare la categoria di genere nelle due lingue indoeuropee, l’italiano e il polacco, postulando una netta distinzione tra il fenomeno grammaticale, operante in primis all’interno del sistema nominale, e la codifica del sesso del referente umano (genere naturale), la quale avviene attraverso diversi mezzi linguistici, usati in alternativa o in combinazione.

Alina Masla - Primo Levi e i suoi russismi

Il presente intervento è volto a fotografare lo stato dei russismi nell’italiano contemporaneo. La ricerca si basa principalmente sul corpus VoDIM (Vocabolario Dinamico dell’Italiano Moderno, progetto dell’Accademia della Crusca) e confronta le occorrenze dei prestiti russi nei testi scritti italiani, in particolare in quelli dello scrittore Primo Levi (https://www.primolevi.it/it), Se questo è un uomo, La tregua, Il sistema periodico, La chiave a stella e I sommesi e i salvati.

Il VoDIM è basato su dizionari in formato digitale come il Tommaseo-Bellini, la quinta Crusca ed ilBattaglia, che dal 9 maggio 2019 è consultabile gratuitamente online www.gdli.it, e coinvolge gruppi di ricerca di otto università italiane, tra i quali anche il gruppo torinese. Il VoDIM è funzionale allo sviluppo di un dizionario online dell’italiano postunitario (Barbera 2018; Marazzini, Maconi 2018; Barbera, Marello 2018).

Nei lavori di Orioles (2006), Nicolai (1994, 2003) e vari dizionari della lingua italiana sono stati individuati circa 300 elementi lessicali di origine russa, la presenza e l’uso dei quali nel corpus VoDIM viene analizzata nel presente studio. Orioles (2003: 109) classifica i russismi nel GRADIT (Grande Dizionario Italiano dell’Uso di Tulio De Mauro) come ‘esotismi in senso stretto’, unità lessicali adattate e ‘esotismi non adattati di ambito tecnico e specialistico’ (cfr. Orioles 2006, 2011; Nicolai 1994; Marello, Masla 2016). I dati del dizionario Parole straniere nella lingua italiana di De Mauro e Mancini (2003) collocano il russo con 135 parole al settimo posto nella classifica dei forestierismi nel lessico italiano, dopo l’inglese (5510), il francese (1729), lo spagnolo (413), il tedesco (341), l’arabo (228) e il giapponese (181).

Mentre i forestierismi provenienti da una lingua che usa un sistema di scrittura simile alla lingua percepente non creano gravi problemi di assimilazione, nel caso del russismo, in partenza scritto in un alfabeto diverso da quello italiano, si generano obiettive difficoltà di traslitterazione. Nei testi di Primo Levi analizzati, lo scrittore non adotta un’unica resa grafica per la stessa parola, per esempio водка è attestata come ‘vodca’ e ‘vodka’. Interessante è anche la formazione delle forme plurali dei russismi, così ‘vodka’ perde la ‘k’ e diventa ‘vodche’, il che non accade per il plurale di ‘trojka’, ‘trojke’.

Il lavoro analizza anche il modo in cui vengono resi i russismi di Levi nelle traduzioni dei suoi testi in russo.

 

Bibliografia (selezione)

Barbera M., Approssimazioni al VoDIM, in Italiano digitale, VII, 2018/4, pp. 138-158.

Barbera M., Marello C., Newsgroup e lessicografia: dai NUNC al VoDIM, in JADT ‘18, Proceedings 14th International Conference on the Statistical Analysis of Textual Data (Rome 12-15 June 2018),Vol I, Roma, Universitalia, 2018, pp. 76-82.

Gherbezza E., Prestiti lessicali fra italiano e russo, in Russica Romana, Vol XX, Pisa・Roma, Fabrizio Serra editore, 2013, pp. 117-128.

Gherbezza E., Sull’italiano « oligarca». Note a margine di una parola nuova, in Studi di lessicografia italiana, Vol XXXII, Firenze, Lettere, 2015, pp. 243-261.

Marazzini C., Maconi L., Il Vocabolario dinamico dell’italiano moderno rispetto ai linguaggi settoriali. Proposta di voce lessicografica per il redigendo VoDIM, in Italiano digitale, VII, 2018/4, pp. 98-115.

Marello C., Masla A., Lemmi traslitterati tra integrazione ed estraneità. Il caso dei russismi nei dizionari italiani, in Bonola A., Gatti M. C. (a cura di), Cultura e ideologia nei vocabolari. Lessicografia russa e italiana a confronto, Milano, EDUCatt, 2016, pp. 91-112.

Nicolai G. M., Viaggio lessicale nel paese dei soviet. Da Lénin a Gorbačëv, Roma, Bulzoni, 1994.

Nicolai G. M., Dizionario delle parole russe che s’incontrano in italiano, Roma, Bulzoni, 2003.

Orioles V., Voci di origine russa in italiano, in Linguistica, Lubiana, 43/2003, pp. 109-118.

Orioles V., I russismi nella lingua italiana. Con particolare riguardo ai sovietismi, Roma, Il calamo, 2006.

Orioles V., Russismi in Enciclopedia dell’Italiano (EncIt) diretta da Simone R., vol 2, Istituto della Enciclopedia italiana, Roma 2011, pp.1265-1267, http://www.treccani.it/enciclopedia/russismi_(Enciclopedia-dell'Italiano)/.

Ziffer G., Il russo, l’italiano e le altre lingue, in Moracci G. (a cura di), Incontri fra Russia e Italia. Lingua, letteratura e cultura, Milano, LED, 2017, pp. 21-28.

Rosanna Benacchio - A proposito dell'uso dell'aspetto verbale al presente in serbo e croato: un confronto col russo

Nel presente lavoro si prende in esame l’uso dell’aspetto verbale nelle forme del presente in serbo e croato, dove, come è noto, in determinati contesti (quelli iterativi, quelli atemporali quali il presente storico o gnomico, quelli interrogativo-negativi, ecc.) si registrano delle oscillazioni nell’uso di PF e IPF sconosciute, per esempio, al russo. Limitandoci qui al primo caso, quello cioè dell’azione iterata (Kad sam žedan popijem pivo vs. Кad sam žedan pijem pivo), vedremo il ruolo fondamentale che hanno la caratteristica azionale del verbo e il contesto, in grado (o meno) di esprimere un’azione risultativa. Nel primo caso, nonostante si tratti di azione iterata, può comparire PF, nel secondo la scelta obbligata è IPF. Il materiale d’analisi, preso dai corpora, verrà sottoposto a verifica da parte degli informanti.

Jelena Božović, Marija Runić - Looking behind the scenes: language policy mechanisms in Brčko District’s educational setting

The aim of this paper is to address some of the key aspects of language policy (LP) processes occurring within the multi-ethnic educational setting of Brčko District (Bosnia and Herzegovina, BiH). Brčko District is a self-governing administrative unit established within the post-war BiH upon international arbitration several years after the end of the armed conflict. Being rebuilt under strong international supervision, the District followed a somewhat different path from that of the other two administrative units, the predominantly Serbian entity called Republika Srpska and the predominantly Bosniak and Croat entity called the Federation of BiH. With the goal of creating a tolerant and democratic multi-ethnic society, composed relatively evenly of the three previously warring ethnicities, the international community invested great deal of efforts into Brčko’s political, economic, and social development. These efforts were inevitably reflected in the question of language policies. Namely, Brčko District is unique within the post-war BiH in having consistently implemented in public administration and education the 'three official languages' policy (Stojkanović 2015). This policy prescribes the use of three languages (Bosnian, Croatian, and Serbian) and two scripts (Latin and Cyrillic) on equal terms for all official purposes. The creation of such LP stems from the necessity to guarantee to each ethnic group the right to its own variant of the previously shared language, known as Serbo-Croatian or Croato-Serbian prior to the conflict.

This paper comes about as part of a broader investigation of LP processes in Brčko District. Being a domain where the question of language policies carries particular weight considering a highly divided society of BiH, we focus our attention on LP processes within the District’s educational sector. In so doing, we draw on the conceptual and theoretical framework referred to as the ethnography of language policy (Hornberger & Johnson 2011, Johnson 2013). Following elaborations of the concept of LP developed within the previous scholarship, Johnson (2013) formulates a comprehensive definition which we will be relying on. This definition views language policy as a “policy mechanism that impacts the structure, function, use, or acquisition of language” and includes: 1) official regulations, but also 2) unofficial, covert, de facto, and implicit mechanisms, as well as 3) processes driven by a diversity of language policy agents, and 4) policy texts and discourses influenced by the ideologies and discourses unique to that context (Johnson 2013: 9). Language policy, therefore, is not merely a static mechanism limited solely to policy documents and official top-down regulations, but it involves highly dynamic processes consisting of the language policy creation, as well as its interpretation and appropriation by multiple agents across multiple contexts (Hornberger & Johnson 2011, Johnson 2013). The research presented in this paper probes into less visible mechanisms of LP processes, i.e. “the unofficial, covert, de facto, and implicit mechanisms, connected to language beliefs and practices, that have regulating power over language use and interaction within communities, workplaces, and schools” (Johnson 2013: 9). Our methods included document analysis (of policy documents, reports, curricula) as well as a field-based research involving observation, field notes, and interviews with identified agents (teachers, students, school management, an international organization involved in the educational policy development, and representatives of ethno-national cultural associations which proved to also play a role). The collected data, both textual and oral, have provided us with insightful accounts of how language policies work in practice, as well as with discursive input that additionally helps us to identify the dominant language ideologies (or beliefs), which both affect and are affected by these practices (Shohamy 2006). We will thus also base our analysis on the analytical concept of language ideologies, defined broadly as “sets of beliefs about language” (Silverstein 1979) or, more specifically, as “conceptions of language and language use: conceptions of “quality,” value, status, norms, functions, ownership, and so forth” (Blommaert 2006: 241), which can be either explicitly expressed or rather implicit and embodied in communicative practice (Kroskrity 2004).

We start by examining the official language-in-education policies and regulations concerning the teaching and the use of the three official languages in secondary schools. While the three mother tongues are being taught separately, as in the rest of the country, students attend all other classes together. Such model is regarded as highly successful within the post-war BiH, due to the fact that the other two territorial entities are rather known for either assimilation or segregation practices and failed attempts to achieve more integrated educational set-up. However, our research reveals that even in a highly integrated setting such as Brčko, the same dominant language ideologies persist as elsewhere in the former Serbo-Croatian linguistic area (see e.g. Kapović 2020, Kordić 2010), often at odds with the officially proclaimed policies of equality and tolerance. These dominant language ideologies are all tightly tied to the ethno-national identities of the three groups. They are mainly centered on questions of status (recognition of all three languages and two scripts as separate and equal in their own right), name (mainly concerning the heavily contested Bosnian language), and choice (deciding which of the languages and scripts should be used, where and when). These ideologies manifest themselves through practices ranging from complete exclusion (ignoring the existence of the other two languages and their speakers) to full inclusion (insisting on the use of the three languages and two scripts). On the other hand, there is also another set of beliefs, a very tacit one and in opposition to those strictly related to ethno-national concerns. Namely, while the sharp boundaries between languages are consistently claimed as key markers of ethno-national identities, we also observe that speakers from all of the three ethnicities are also very much aware of the fact that their languages are “very similar”, “almost the same”, and hence fully mutually intelligible. Such conception is in fact the underlying assumption of the official education policy which envisages that children attend together all subjects apart from their mother tongue, while the language of instruction is the language used by the teacher, regardless of his/her ethnicity. This mechanism of the official language policy is thus a very covert and implicit one, yet it could be argued that it is the cornerstone of the successful integration of the previously segregated education in Brčko District. Finding contradictory ideological orientations within a single language policy enactment is by no means a novelty (Johnson 2013, Shohamy 2006). However, which one will prevail and be deployed in the overall language policy processes within the setting we examined, depends mainly on two (out of five) key dimensions of language ideologies identified by Kroskrity (2004: 501-509), i.e. on how productively they will be used in the pursuit of specific interests and in identity representation within specific context and situation.

References:

Blommaert, J. (2006) Language policy and national identity. In T. Ricento (ed.) Language Policy.
Theory and Method
. Malden, Oxford, Carlton: Blackwell, 238–254.

Hornberger, N. H. & Johnson, D. C. (2011). The ethnography of language policy. In T. L. McCarty (Ed.), Ethnography and Language Policy. New York: Routledge, 273–289

Johnson, D. C. (2013). Language policy. New York: Palgrave Macmillan.

Kapović, M. (2020), ‘Bosnian/Croatian/Montenegrin/Serbian: Notes on contact and conflictʼ, in M. Rudolf, M. Castells, J. Angel J. & J. Rueter (eds), European Pluricentric Languages in Contact and Conflict (Berlin, Peter Lang), 171-184.

Kordić, S. (2010). Jezik i nacionalizam. Zagreb: Durieux.

Kroskrity (2004). Language ideologies. In A. Duranti (ed.) A Companion to Linguistic Anthropology. Malden, Oxford, Carlton: Blackwell Publishing, 498–517.

Shohamy, E. (2006). Language Policy: Hidden Agendas and New Approaches. London and New York: Routledge.

Silverstein, M. (1979) Language structure and linguistic ideology. In P. Clyne, W. Hanks & C. Hofbauer (eds) The Elements. Chicago: Chicago Linguistic Society, 193–248.

Stojkanović, A. R. (2015). Sociolingvistička analiza jezičke politike u postdejtonskoj Bosni i Hercegovini. (Doctoral dissertation, University of Belgrade) Retrieved from: http://uvidok.rcub.bg.ac.rs/handle/123456789/430

 

Alessandro Maria Bruni - Per lo studio della perifrasi verbale paleoslava composta dal verbo essere (byti) e dal participio presente

La relazione ha come oggetto l’analisi della perifrasi verbale slava ecclesiastica antica costituita dall’unione del verbo “byti” (essere) con il participio presente. Tale costrutto si trova sia in testi tradotti dal greco sia in opere originali, riferibili alla letteratura slava orientale. Alla luce di ciò la maggior parte degli studiosi la considerano come un calco dal greco, anche se non mancano quelli che la ritengono di origine slava. Il suo studio presenta pertanto non pochi problemi ancora irrisolti. Se l’attenzione dei linguisti si è finora concentrata soprattutto sugli esempi rinvenibili delle versioni paleoslave del Nuovo Testamento, il presente contributo si propone invece di esaminare alcune tra le occorrenze rinvenibili nelle traduzioni dell’Antico Testamento.

Salvatore Del Gaudio - Alcune osservazioni sugli elementi bielorussi e russi nel dialetto nord ucraino di Vyšneve

Il dialetto locale[1] di Vyšneve[2] rappresenta il punto di partenza di uno studio individuale di più ampia portata sui dialetti di confine[3] tra Ucraina, Bielorussia e Federazione Russa.

Le caratteristiche generali di questo dialetto sono già state evidenziate in lavori precedenti. Tuttavia tra i diversi aspetti non sufficientemente esaminati restano alcune peculiarità fonetiche, morfologiche e lessicali che questo e altri dialetti adiacenti condividono con il bielorusso e il russo. Nella relazione proveremo ad evidenziare alcuni di questi tratti con il fine di separare gli interferemireali da quelli presunti.

[1] Cf. ucr. hovirka, rus. govor, bel. havorka.

[2] Si tratta di un villaggio rurale situato nel distretto di Ripky, nell’estremità nord-occidentale della regione di Černihiv (Ucraina).

[3] Nella letteratura specialistica tali dialetti sono parimenti noti come “dialetti di transizione”.

Pavel Duryagin - The effect of speech rate on realization of nuclear pitch accents in two Russian rising tunes

The present study examines the effect of speech rate on the distribution and phonetic realization of Russian pitch accents in the context of enumeration. Namely, its aim was to test the observations found in the literature on Russian prosody which claim that non-final elements in the list can be marked by two or three interchangeable rising pitch configurations. Tentative ToBI-like notations for these accents will be used here. On the one hand, the nuclear accent used in polar questions (followed by low boundary tone L%) and in enumeration / exclamation / positive qualification contexts [1] (followed by high boundary tone H%) will be referred to as L*+H, following [2]. On the other hand, the nuclear accent normally used in contrastive questions followed by H% will be referred to as L*.

            According to traditional descriptions of Russian prosody, both pitch accents are used in enumeration contexts where the choice of tune marks stylistic and pragmatic differences [3]. While L*+H is described as neutral colloquial variant (when followed by L%) or “emotional”, “solemn” (when followed by H%), the L* H% configuration is characterized as “formal”, “official”, typical for “newsreaders’ speech”. Since it is difficult to formalize these parameters and manipulate them in experimental conditions, it was hypothesized in this paper that some of them actually reflect the effects of intentional changes in speech rate.

            To test this hypothesis an experiment was conducted in which 25 native speakers of Standard Russian (18 female and 7 male) read aloud four texts containing typical contexts in which the use of L* and L*+H was expected (contrastive question and enumeration, respectively). Three pairs of stimuli were constructed that had similar segmental structure, for example: АЛёня? (‘And what about Lyonya?’) and Сначаланиктонехотел, нопотомвызвалисьИгорь, АлёнаиСаша (‘At first no one wanted, but then Igor, Alyona and Sasha volunteered’). The number of postnuclear syllables varied between the pairs of stimuli but was controlled for within the pairs. The participants were instructed to read the texts containing the stimuli three times: first, in normal tempo (“comfortable for you”), then slowly (“as if you were telling a story thoroughly”), and, finally, in fast tempo (“as if you were a bit in a hurry”).

            After some tokens were discarded from the analysis for various reasons (the use of falling pitch accent, failure to trace the F0 curve, poor record quality, etc.), the resulting 360 phrases were segmented and labelled in Praat. Absolute and relative alignment of the local F0 minima and maxima were measured, as well as the excursion and slope of the rising movements. For each of these parameters a linear mixed-effect regression model was fitted in R [4] by means of lme4package [5] with independent variables context (enumeration vs. contrastive question), stimulus (the three stimuli with varying syllable structure), speech rate (normal vs. slow vs. fast) and a random intercept for participant. The results of modelling are omitted here due to the limited space.

            The data show systematical differences in alignment between the two syntactic contexts. The local F0 minima and maxima were placed consistently later in contrastive questions than in enumeration contexts. In addition, significant differences in the excursion of the rise were found, but only in the contexts with two or more postnuclear syllables. Although the perceptual discreteness of these phonetic differences is yet to be tested, the data are consistent with the phonological interpretation adopted here.

            Unexpectedly, the effect of tempo manipulations was not symmetrical for fast and slow conditions. Measurements obtained from the high speech rate recordings are in line with segmental anchoring hypothesis (first formulated in [6]) and indicate the stability of alignment for local minima and maxima, as well as constant scaling differences between the targets. Only the slope of the rise varied under this experimental condition. Similar results were previously reported by Igarashi for falling Russian accents [7]. Contrary to that, a strong effect of slow tempo on L and H alignment, as well as on F0 excursion was found in the data. Under this experimental condition local pitch minima and maxima were placed consistently later than in normal and fast tempo.

Two interpretations of these results can be proposed. First, this “rightward shift” might indicate that, in accordance with the impressionistic descriptions of Russian prosody, Russian speakers substitute L*+H T% with L* H% in stylistically marked contexts for enumeration that have a common feature “speaking slowly”. However, this notion does not explain the fact that slow tempo affected likewise the pitch targets in contrastive questions. This evidence can be interpreted as indicative that, contrary to the segmental anchoring hypothesis, alignment in Russian is consistently affected by slow speaking tempo.

To deepen the understanding of these findings, further investigations are needed that will consider not only the phonetics and phonology of the nuclear accents L* and L*+H, but also their interaction with largely understudied Russian prenuclear and boundary accents.

Literature

[1] C. Odé, Transcription of Russian Intonation: a free interactive research tool and learning module. Accessed on Aug. 10, 2020. [Online]. Available: http://www.fon.hum.uva.nl/tori/

[2] T. Rathcke, “On the neutralizing status of truncation in intonation: A perception study of boundary tones in German and Russian”, J. Phon., 41, pp. 172–185, 2013.

[3] E. A. Bryzgunova, “Intonacija,” in Russkaja grammatika, vol. 1, Moscow: Nauka, 1980, pp. 96–122.

[4] R Core Team. R: A language and environment for statistical computing. R Foundation for Statistical Computing, Vienna, Austria. www.R-project.org.

[5] D. Bates, M. Maechler, B. Bolker, S. Walker, “Fitting Linear Mixed-Effects Models Using lme4,” Journal of Statistical Software, vol. 67, no. 1, pp. 1–48, 2015.

[6] A. Arvaniti, D. R. Ladd, I. Mennen, “Stability of tonal alignment: The case of Greek prenuclear accents”, J. Phon, 26, pp. 3–25, 1998.

[7] Y. Igarashi, ""Segmental anchoring" of F0 under changes in speech rate: evidence from Russian",Proceedings of Speech Prosody 2002, 2002, pp. 25-28.

 

Jacopo Garzonio e Silvia Rossi - Le preposizioni come categoria funzionale o lessicale? Il caso del russo

Le preposizioni sono tradizionalmente suddivise in due gruppi sulla base di proprietà morfosintattiche e semantiche: funzionali e lessicali (o anche semplici e complesse, oppure primarie e secondarie). In questo contributo, in cui prendiamo in esame il sistema del russo e lo consideriamo nel quadro delle lingue slave e in comparazione con i sistemi romanzo e germanico, intendiamo proporre una classificazione più articolata, basata sulle analisi di tipo cartografico del sintagma preposizionale (cfr. tra molti altri Svenonius 2007; Terzi 2008; Cinque 2010).

Julija Nikolaeva - La lingua di Turgenev alla luce della norma linguistica russa contemporanea

Il contributo analizza la lingua turgeneviana nel contesto dell’evoluzione semantico-sintattica avvenuta nella lingua russa negli ultimi 150-200 anni. Molti fenomeni linguistici ottocenteschi, tuttora poco studiati, sembrano quasi identici all’uso linguistico odierno, ma in realtà celano significative differenze. Vengono presi in esame i numerosi piccoli slittamenti diacronici che delineano una nuova combinatoria paradigmatica delle parole e che hanno una forte ricaduta sulla semantica. I cambiamenti diacronici riscontrati nei testi di Turgenev ulteriormente sono confrontati con altri testi ottocenteschi per dimostrare il loro carattere trasversale nella lingua russa di quel periodo.

 

BREVE BIBLIOGRAFIA

Bulakhovskij L. A., Russkij literaturnyj jazyk pervoj poloviny XIX veka. Moskva, 1954.

Dobrovol’skij D.O.,  K dinamike uzusa (jazyk Puškina i sovremennoe slovoupotreblenie), in: Russkij jazyk v naučnom osveščenii, 2001, N° 1, M., 161 – 178.

Es’kova N.A., Normy russkogo literturnogo jazyka  XVIII—XIX vekov: Slovar’. Pojasnitel’nye stat’i. Moskva, 2008.

Kalinovskaja V.N., Russkij jazyk XIX veka: dinamika jazykovych processov. Sankt -Peterburg, 2008 . Acta linguistic Petropolitana, 2008, vol. IV, parte 3.

Padučeva E. V., Iz nabljudenij nad jazykom L. Tolstogo (k voprosu o malych diachroničeskich sdvigach), in: Voprosy jazykoznanija, 2018, N° 5,  49-63.

Pen’kovskii A. B., Očerki po russkoj semantike. Moskva, 2004.

Plungian V., Rakhilina E. I say …’: Some aspects of 19th-century Russian syntax, in: Russian Linguistics, 2018, 42, 2, 123-136.

Rakhilina E. V., Reznikova T.I., Borodina M.A. “Taman’ segodnja”: korpusnoe issledovanie russkogo jazyka XIX veka, in: Trudy instituta russkogo jazyka im. V.V. Vinogradova,2016,  № 10, 242-255.  

Svetlana Nistratova - Particolarità semantico-lessicali e pragmatiche degli appellativi russi

Scopo della presente ricerca non è la descrizione del sistema standard degli appellativi russi, in quanto si presuppone che esso sia stato descritto con sufficiente completezza e sia conosciuto da tutti i parlanti della lingua russa, bensì l’analisi dei casi di deviazione dallo standard e delle differenze con gli appellativi  italiani. Le deviazioni dallo standard presentano un interesse sia teorico che pratico (per l’insegnamento del russo agli italiani). Di norma vi si dedica una scarsa attenzione nello studio del russo come lingua straniera e ciò è causa di difficoltà, per gli italiani, nelle concrete situazioni della comunicazione orale e scritta. Le specificità dell’uso degli appellativi russi sono analizzate in relazione alla categoria della cortesia non solo dal punto di vista della etichetta linguistica, ma tenendo conto delle loro caratteristiche lessico-semantiche e pragmatiche. Viene sfiorato anche il tema dei  nuovi  appellativi usati in diversi ambiti, nel russo contemporaneo.

Bibliografia

Алпатов В.М. Категория вежливости в современном японском языке./ Отв. ред. И.Ф. Вардуль. 2-е изд., доп. М.: КомКнига, 2006.

Арутюнова  Н.Д. Язык и мир человека. М.: Языки русской культуры, 1998.

Балакай А.Г. Словарь русского речевого этикета, 3-е изд., испр. и доп. М.: АСТ; Астрель; Хранитель, 2007.  

Бурас М.М., КронгаузМ.А. Обращения в семейном этикете: семантика и прагматика.// ВЯ, №2, 2013, сс. 121-131.

Высоцкая В.В. Система русских обращений в историческом аспекте: конкурирующие тенденции. // Конкуренция в языке и коммуникации. М.: РГГУ. Институт лингвистики, 2017, с.76-91.

Гольдин В.Е. Обращение: теоретические проблемы. 2-е изд., испр. доп. М., 2009.

Карасик В.И. Язык социального статуса М.: Гнозис, 2012.

Кожухова Л.В. Речевой акт обращения. // Вестник Ставропольского гос.университета. 2007, №48, с. 80-85.

Кронгауз М.А. Обращения как способ моделирования коммуникативного пространства. // Логический анализ языка. Образ человека в зеркале разных языков и культур. М.: Индрик, 1999, c.124-134.

Крысин Л. П. Современный русский интеллигент: попытка речевого портрета. // Русский язык в научном освещении. № 1. М., 2001, с. 90-106.

Кульпина В.Г. Вежливость и ее антиподы в категориях языковой вариативности, оценочности и социальной нормы. // Вежливость и антивежливость в языке и коммуникации. Материалы Международной научной конф., состоявшейся в Институте лингвистики РГГУ 23-24 октября 2018 г. Сост. и отв. ред. И.А. Шаронов. М.: Политическая энциклопедия, 2018. с. 122-132.

Трищенко И.В. Особенности иронических обращений. // Тезисы конф. "Функциональные и семантические корреляции языковых единиц". Киев, 1990, с. 197-198.

Ратмайр Р.  Прагматика извинения: сравнительное исследование на материале русского языка и русской культуры. М.: Языки славянской культуры, 2003.

Федорова Л.Л. Обращения душенька и голубчик в художественных текстах (по данным НКРЯ). // Вежливость и антивежливость в языке и коммуникации. Материалы Международной научной конф., состоявшейся в Институте лингвистики РГГУ 23-24 октября 2018 г. Сост. и отв. ред. И.А. Шаронов. М.: Политическая энциклопедия, 2018, с.264-276.

Формановская Н.И. Речевое взаимодействие:коммуникация и прагматика. М., 2007.

Янко Т.Е. Обращения: лексическая семантика, прагматика, культурная традиция. // Вежливость и антивежливость в языке и коммуникации. Материалы Международной научной конф., состоявшейся в Институте лингвистики РГГУ 23-24 октября 2018 г. Сост. и отв. ред. И.А. Шаронов. М.: Политическая энциклопедия, 2018, с. 308-315.

Braun F. Terms of address: Problems of patterns and usage in various languages and cultures. Berlin, 1988.

Monica Perotto - Acquisizione del russo e traduzione negli heritage speakers russofoni e negli studenti di RKI

Gli studi sull’acquisizione della lingua russa nei parlanti definiti heritage speakers riguardano principalmente l’acquisizione di competenze linguistiche morfosintattiche, stilistiche o lessicali, ma non traduttive. Queste ultime sono difficili da conseguire anche per i parlanti bilingui, poiché la traduzione non rientra fra i metodi didattici più spesso impiegati nelle cosiddette subbotnie školy. Per l’analisi di alcune categorie linguistiche si sono rivelati di particolare interesse i risultati delle traduzioni letterarie di testi per l’infanzia svolte dagli HS per il concorso “Kul’turnyj most” e confrontate con le traduzioni eseguite da un gruppo di studenti dell’Università di Bologna.

Jacopo Saturno - Genere grammaticale e accordo nell’acquisizione del russo L2

Questo lavoro descrive una specifica tipologia di interferenza riscontrabile nell’acquisizione del russo L2 da parte di apprendenti italiani. In particolare, si presenta un’analisi degli errori di accordo dovuti alla discrepanza tra L1 e L2 nell’assegnazione del genere grammaticale ad alcuni sostantivi privi di sesso biologico (es. piscina vs. bassejn). La domanda di ricerca è affrontata mediante un esperimento acquisizionale, in cui a venti studenti universitari si chiedeva di tradurre oralmente in russo alcune frasi contenenti la struttura bersaglio. Le variabili prese in esame includono 1) l’ordine lineare di nome e elemento concordato e 2) il tipo di struttura bersaglio, cioè a) accordo nome-aggettivo, b) accordo nome-verbo, c) ripresa pronominale del nome. Nel quadro teorico del processing determinism (O’ Grady 2015), i risultati sono interpretati alla luce degli studi sulla struttura del lessico mentale nei bilingui.

Nadezda Studenikina - “Parole alate” del momento: il fenomeno dei internet meme (sul materiale della lingua russa)

L’intervento analizza le caratteristiche linguistiche ed extralinguistiche dei internet meme, unità multimodali popolari nella comunicazione web odierna. Il materiale della ricerca è stato rilevato grazie allo spoglio del segmento russofono di internet. La semantica dei internet-meme viene formata nell’interazione dei mezzi verbali e non verbali ed è legata ai meccanismi cognitivi di implicazione logica, inferenza e dissonanza cognitiva. I meme di internet vengono esaminati come una specie di precedentnye fenomeny in possesso della forte connotazione culturale.  La loro analisi permette, oltretutto, di evidenziare i meccanismi della creatività linguistica attivi in russo contemporaneo.

 

Andrea Trovesi - L'uso del vocativo in alcuni manoscritti paleoslavi. All'origine del “caso”

Si è portati a credere che in base al grado di integrità della segnalazione morfologica del caso vocativo le lingue slave possano essere classificate come tendenzialmente conservative oppure come tendenzialmente innovative e che, di conseguenza, i testi slavi più antichi dovrebbero mostrare scenari di maggiore coerenza nell’uso delle marche di vocativo. Un’analisi più attenta e circoscritta, invece, rileva un quadro diverso: anche nei testi più antichi l’occorrenza del vocativo, caso “anomalo” (segnalazione morfematica attraverso “desinenze di caso” per l’espressione di valori pragmatici, come, ad esempio, “l’appello”), mostra una certa incoerenza. Partendo così dai manoscritti antico slavi, redatti, cioè, in paleoslavo o in antico slavo ecclesiastico, la varietà linguistica che si ritiene più prossima al protoslavo, l’analisi sarà condotta sulle parti più dialogiche dei Vangeli o Evangeliari (Codice Zografense, Codice Mariano, Codice Assemaniano, Libro di Savva etc.), così come sui passaggi contenenti potenziali forme di vocativo di altri tipologie di testo (Salterio sinaitico e Eucologio sinaitico, Codice Cloziano, Codice Suprasliense, etc.), tutti appartenenti al canone dei manoscritti paleoslavi, oppure precedenti (Fogli di Kiev) o cronologicamente paralleli (Frammenti di Frisinga).

L’indagine verterà, come nei precedenti lavori sul vocativo, sull’identificazione di tendenze d’impiego, e ciò, innanzitutto, sia a livello formale, nel tentativo di determinare con quali nomi, propri o comuni, le desinenze di vocativo meglio si conservano e se tutte le marche morfologiche vocative ereditate dal protoslavo vengono correttamente impiegate secondo la distribuzione prevista per modelli flessionali; in secondo luogo, da una prospettiva funzionale e pragmatica, si cercherà di individuare delle regolarità nell’uso del vocativo, le quali potrebbero oscillare da una assoluta obbligatorietà – tutte le volte cioè che sono rispettati i parametri pragmatici dell’appello, sia “vero e proprio” che “assiologicamente marcato” – fino ad un uso occasionale, in base a parametri comunicativi che andranno sondati e indagati nel lavoro.

Il quadro teorico di riferimento è quello elaborato per le lingue slave contemporanee e di cui attraverso esempi reali e concreti è stata testata la coerenza dell’uso, la distribuzione, i parametri comunicativi e pragmatici che la regolano, il suo assottigliamento funzionale e il parallelo assorbimento “morfologico”, che può subentrare al termine dell’evoluzione del caso vocativo morfologicamente marcato. Il vocativo “si estingue” dal punto di vista morfologico, ma non da quello funzionale: tale ruolo è infatti assunto dal nominativo, come nelle lingue romanze e germaniche o, tra le slave, in modo particolarmente evidente in russo.

 

Bibliografia

Donati, Margherita (2010). "Per una teoria del vocativo. Persona, sistema e asimmetria". Linguistica e Filologia, 30, 11-47.

Stifter, David (2013). "Vocative for nominative." In: Sonnenhauser, Barbara; Noel Aziz Hanna, Patrizia (Hrsg.), Vocative! Addressing between System and Performance, Berlin, de Gruyter Mouton, 43–85

Topolińska, Zuzana (1973). "Vocativus – kategoria gramatyczna." Jel.nek, Milan; Grepl, Miroslav (red.), Otázky slovanské syntaxe, III. Modální výstavby výpovědi v slovanských jazycích. Brno: Universita J. E. Purkyně, 269-74.

Trovesi, Andrea (2008). "Il vocativo nelle lingue slave: un quadro articolato." Linguistica e Filologia, 26, 207-34.

Trovesi, Andrea (2010). "Instabilità categoriale e oscillazioni funzionali del vocativo nelle lingue slave. Casi di convergenza funzionale tra vocativo e vezzeggiativi." Benacchio, Rosanna; Ruvoletto, Luisa (a cura di), Lingue slave in evoluzione. II Incontro di Linguistica slava. Padova: Unipress, 179-90.

Trovesi, Andrea (2012). "Desinenze di vocativo come formanti antroponimici. I nomi propri maschili in -e e - o nelle lingue slave." Biagini, Francesca; Slavkova, Svetlana (a cura di), Contributi allo studio della morfosintassi delle lingue slave. Bologna: Bononia University Press (http://mediazioni.sitlec.unibo.it), 394-406.

Trovesi, Andrea (2014). "Forme non normative di vocativo in ceco. Accettabilità e valori stilistico-pragmatici." Bonola, Anna; Cotta Ramusino, Paola; Goletiani, Liana (a cura di), Studi italiani di linguistica slava. Strutture, uso e acquisizione, Firenze, 2014: 347-368.

Victoriya Trubnikova - Chočesh kusoček tortika: dimensione morfopragmatica nella lingua russa

In questa proposta viene esplorata l’appropriatezza dell’uso dei diminutivi da parte dei parlanti nativi di russo di diverse età e genere.

In vista dell’ipotesi che “il diminuire” avviene non solo a livello proposizionale ma anche a livello illocutorio e perlocutorio (Dressler, Merlini Barbaresi 1994), questo studio parte dal presupposto che il significato pragmatico dei diminutivi abbia la capacità di modulare la forza illocutoria degli enunciati e di provocare degli effetti che esulano dalla prospettiva della mitigazione.

A questo proposito, sono stati presi in esame vari articoli divulgativi, podcast e commenti nei forum che discutono sull’inappropriatezza del valore diminutivo nelle parole appartenenti a vari campi semantici. È stato inoltre elaborato un questionario contenente un elenco degli enunciati con diverse forme diminutive per indagare la percezione emotiva dei parlanti nativi e per individuare gli effetti perlocutori dei diminutivi.

È stato individuato che l’impiego delle forme diminutive negli enunciati può essere trattato dal punto di vista della:

  • cortesia negativa (come mitigazione dell’imposizione);
  • cortesia positiva (come riduzione della distanza psicologica).

Ci si era prefissi lo scopo di indagare anche le fonti dei fallimenti pragmatici, e quindi la percezione negativa dei diminutivi in base alla valutazione soggettiva dei parlanti, e di individuare in quali situazioni comunicative il tratto semantico “non-serio” non risulta appropriato. Basandosi sulle intuizioni dei parlanti, si propone un quadro interpretativo dell’uso contestualmente appropriato delle parole con i suffissi diminuitivi, prendendo in considerazione il tipo di atto linguistico prodotto, il rapporto con l’interlocutore, le variabili situazionali e il mezzo comunicativo usato.

I tratti interazionali più problematici individuati dai parlanti riguardano l’atteggiamento giocoso e ironico del parlante per le questioni che riguardano l’interlocutore, la confidenza costruita ad hoc e orientata a scopi manipolativi, la deresponsabilizzazione per un’azione espressa nell’illocuzione.

Bibliografia:

Dressler, W.U; Merlini Barbaresi, L. 1994, Morphopragmatics: Diminutives and Intensifiers in Italian, German and Other Languages, Mouton de Gruyter, Berlin.

Spiridonova, N.F., 1999, Russkie diminutivy. Problemy obrazovanija i značenija, «Izvestija AN», 58 (2), pp. 20-45.

 

Adamo ed Eva nella fraseologia russa e italiana

Il presente contributo è dedicato all’analisi comparativo-contrastiva delle unità fraseologiche bibliche russe e italiane contenenti gli antroponimi Adamo ed Eva. La Bibbia, il “grande codice” della cultura europea, costituisce infatti una delle principali fonti di arricchimento fraseologico per le lingue dei popoli cristiani, e dunque anche per il russo e l’italiano. I fraseologismi biblici formano, quindi, un gruppo molto cospicuo e significativo di quelli che sono definiti «internacionalizmy» («internazionalismi», Soloducho, 1982), «europeismos culturales» («europeismi culturali», Corpas, 2000) o «widespread idioms» («idiomi di ampia diffusione» Piiranien, 2012). In tal senso, la fraseologia biblica è un patrimonio lessicale comune a tutto il mondo cristiano.

Con il termine fraseologismi biblici intendiamo, in accordo con la definizione proposta da Dubrovina (2010), espressioni stabili e riproducibili nel discorso, pervenuteci direttamente come citazioni dalla Bibbia («letterali») o formatesi indirettamente sulla base di soggetti, temi, personaggi e immagini bibliche («situazionali»), caratterizzate da un’elevata espressività e da significati traslati (metaforici, metonimici, simbolici, allegorici, figurati in generale).

Lo studio della fraseologia di origine biblica è una questione molto attuale della linguistica contemporanea, come dimostra la grande quantità di lavori apparsi negli ultimi anni in tale ambito. L’interesse per fraseologia biblica ha conosciuto un notevole sviluppo in Russia soprattutto in seguito alla caduta dell’Unione Sovietica e alla sempre maggiore attenzione rivolta all’eredità religiosa e biblica nella cultura e lingua russa. Diverse sono infatti le correnti di studio che, da diverse prospettive, si occupano di questo tema, come quella etimologica (Birich, Matešič, 1994; Grigor’ev, 2008), quella contrastiva (Mendel’son, 2002; Gak, 1997; Žolobova, 2005), il funzionamento nei testi (Pribytko, 2002; Klimovič, 2011). Sono stati inoltre redatti vari dizionari di fraseologismi biblici, sia monolingue (Dubrovina, 2010; Mokienko, Lilič, Trofimkina, 2010) che bilingue (Walter, Mokienko, 2009) e multi-lingue (Adamja, 2005; Balakova, Walter, Moienko, 2010). In Italia, al contrario, questo argomento è stato affrontato solo sporadicamente (Beccaria, 2020; Lurati. 2002; Castiglione 2019). Non esistono, tra l’altro, studi dedicati all’analisi contrastiva dei fraseologismi biblici russi e italiani. L’unica studiosa ad essersi occupata, finora, di fraseologia contrastiva tra italiano e russo è Čerdanceva (1982), autrice, tra l’altro, del solo dizionario fraseologico italiano-russo ad oggi esistente, risalente ormai agli anni ’80 e, dunque, un po’ datato. Risulta perciò non ancora sufficientemente investigata l’analisi contrastiva della fraseologia biblica russa e italiana.

La scelta di studiare i fraseologismi biblici contenenti i nomi propri biblici è motivata dal fatto che essi sono divenuti nel tempo metafore universali, simboli per antonomasia, e formano numerose espressioni idiomatiche, la cui base metaforica è costituita dalle caratteristiche distintive dei personaggi che denominano e dalle loro azioni prototipiche. Tali espressioni sono ritenute particolarmente significative per dimostrare che, nonostante l’origine comune, ogni lingua ha il proprio “inventario” di fraseologismi biblici, in quanto ciascun componente onomastico mostra un diverso grado di produttività nella fraseologia russa e italiana. Si distinguono così differenze sia nella quantità che nella composizione qualitativa di queste unità fraseologiche, dovute alla selettività arbitraria e soggettiva di ciascuna lingua nei confronti della realtà oggettiva, in tal caso il testo biblico, all’adattamento specifico degli antroponimi biblici nelle due differenti culture linguistiche e, in generale, a fattori linguistici ed extra-linguistici. Ciò dimostra come il mondo esterno viene modellato in maniera differente da due diversi sistemi linguistico-culturali, risentendo degli influssi nazionali specifici, se è vero, come afferma Babkin, che nella frase idiomatica “lo spirito e l’unicità di una nazione si manifestano in un modo unico” (Baranov, Dobrovol’skij 2002: 222).

Nello specifico, si è focalizzata l’attenzione sui fraseologismi contenenti i nomi dei personaggi biblici Adamo ed Eva, la cui storia viene narrata nel libro della Genesi (1-5), in quanto la cultura dei popoli cristiani ha tratto dalla leggenda di queste figure i più ricchi motivi nella letteratura, nel teatro, nella pittura, nella musica e nella cultura in generale. Essi rappresentano infatti gli archetipi dell’umanità e, sulla base della narrazione biblica, la loro storia costituisce l’inizio della storia della razza umana.

Le immagini di Adamo ed Eva sono alla base di numerose espressioni idiomatiche, che riflettono le diverse caratteristiche di questi personaggi, come ad esempio от Адама <и Евы>da Adamo <ed Eva>, адамово яблокоpomo d’Adamo, вкостюме Адама <и Евы>in costume adamitico<evitico> ecc. Adamo, infatti, è il primo uomo sulla terra e il progenitore della razza umana, ma è anche universalmente associato alla nudità, alla creazione della prima donna, alla disobbedienza nei confronti di Dio, al peccato originale, alla cacciata dal Paradiso, alla punizione, a una vita longeva. Eva è la prima donna, creata da Dio dalla costola di Adamo, simbolo di curiosità,  tentazione e trasgressione, conoscenza e disobbedienza. Tutte queste diverse connotazioni non si riflettono omogeneamente nella fraseologia delle due lingue nelle quali, quindi, sorgono diverse unità, pur motivate dallo stesso soggetto biblico universale.

Questo intervento ha dunque come obiettivo l’analisi approfondita del corpus di espressioni contenenti gli antroponimi  Adamo ed Eva nelle lingue date, per illustrarne le caratteristiche comuni, ma soprattutto quelle nazionali e culturali specifiche, evidenziando, sulla base delle fonti lessicografiche e specialmente dei corpora linguistici, le divergenze morfo-sintattiche, lessicali, semantiche, stilistiche e pragmatico-funzionali (registro stilistico, frequenza d’uso), e analizzando il loro funzionamento nei testi. Solo l’esame dei contesti d’uso, resa possibile grazie al ricorso ai corpora linguistici, nello specifico al corpus parallelo russo-italiano, ci permette, infatti, di riempire le lacune della fraseografia biblica attuale, nonché di individuare le espressioni attestate nell’uso, ma non registrate nei dizionari. Essi, soprattutto quelli bilingue, non sempre forniscono infatti informazioni soddisfacenti riguardo lo stato attuale di questo o di quel fraseologismo, le sue sfumature semantiche, le connotazioni, il funzionamento nei testi. Tali informazioni risutano invece di enorme importanza per la traduzione di queste unità da una lingua all’altra. Cercheremo quindi di distinguere tra espressioni totalmente corrispondenti, espressioni che corrispondono solo parzialmente, che presentano quindi divergenze ai diversi livelli linguistici, e lacune, ossia fraseologismi che esistono in una lingua ma non nell’altra.

Parole chiave: unità fraseologiche bibliche, analisi contrastiva, antroponimi biblici, Adamo, Eva

Bibliografia

Adamija, N., Russko-anglo-nemeckij slovar’ poslovic, pogovorok, krylatych slov i biblejskich izrečenij, Moskva, Nauka: Flinta, 2005.

Balakova, D., Kovačova V., Mokienko V.M., Nasledie Biblii vo frazeologii, Grajfsvald, 2013.

Baranov, A.N., Dobrovolskij, D.O., Osnovy frazeologii (kratkij kurs). Učebnoe posobie,

Moskva, Flinta, 2014.

Beccaria, G. L., Sicuterat. II latino di chi non lo sa: Bibbia e liturgia nell'italiano e nei dialetti, Milano, Garzanti, 2002.

Birich, A., Matešič, J., “Iz istorii russkich biblejskich vyraženij”, Russkij jazyk za rubežom, 5-6, 41-47, 1994.

Čerdanceva, T., Ital’jansko-russkij frazologičeskij slovar’, Moskva, Russkij jazyk, 1982.

Corpas Pastor, G., “Acerca de la (in)traducibilidad de la fraseología”, in Gloria Corpas Pastor (ed.), Las lenguas de Europa: Estudios de fraseologia, fraseografia y traducción, Granada, 483-522, 2000.

Dobrovol’skij, D., “Cross-linguistic equivalence of idioms: does it really exist?”, in Pamies, A., Dobrovol’skij, D. (a cura di), Linguo-cultural competence and phraseological motivation, Baltmannsweiler, Schneider Verlag, 2011, pp. 7-24.

Dubrovina, K.N., Enciklopedičeskij slovar’ biblejskich frazeologizmov, Moskva, Nauka: Flinta, 2010.

Dubrovina, K.N., Biblejskie frazeologizmov v russkoj i evropejskoj kul’ture, Moskva, Nauka: Flinta, 2017.

Frye, N., Il grande codice. La Bibbia e la letteratura, Torino, Einaudi, 2018.

Žolobova, A., Frazeologičeskie edinicy biblejskogo proischoždenija v anglijskom, ispanskom i russkom jazykach. Dissertacija doktora filologičeskich nauk, Kazan’, 2005.

Gak, V.G., “Osobennosti biblejskoj frazeologii v russkom jazyke (v sopostavlenii c francuzskami bibleizmami)”, in Voprosy jazykoznanija, 5, 1997, pp. 55-65.

Grigor’ev, A., Istorija istočnikovedenija russkoj biblejskoj frazeologii, Dissertacija doktora filologičeskich nauk, Moskva, 2008.

Klimovič, N., Bibleizmy v chudožestvennom tekste: tipologičeskij, funzkional’nyj i perevodčeskij aspekty, Dissertacija kandidata filologičeskich nauk, Irkutsk, 2011.

Lurati, O., Per Modo di dire...Storia della lingua e antropologia nelle locuzioni italiane ed europee, Bologna, CLUEB, 2002.

Mellado Blanco, C., “Parámetros específicos de equivalencia en las unidades fraseologícas (con ejemplos del español e alemán)”, in Revista de filología, 33, Santiago de Compostela, 2015, pp. 153-174.

Mendel’son, V., Frazeologičeskie edinicy biblejskogo proizchoždenija v anglijskom i russkom jazykach. Dissertacija kandidata filologičeskich nauk, Kazan’, 2002.

Mokienko, V.M., “Adam v slavjanskich jazukach”, in Čislo. Jazyk. Tekst: Sb. statej k 70-letiju Adama Evgen’eviča Supruna, Minsk, Belgosuniversitet, 1998, pp. 14-28.

Mokienko, V., Lilič, Trofimkina, Tol’kovy slovar’ biblejskich vyraženij i slov. Okolo 2000 edinic, Moskva, Astrel’, 2010

Piirainen, E., Widespread idioms in Europe and Beyond. Toward a Lexicon of Common Figurative Units, New York, Peter Lang Publishing, 2012.

Pibytko, E., Bibleizmy v jazyke sovremennych gazet, Dissertacija kandidata filologičeskich nauk, Voronež, 2002.

Soloducho, E., Problemy internazionalizacii frazeologii (na materiale jazykov slavjanskoj, germanskoj i romanskoj grupp), Kazan’, Izd-vo KGU, 1982.

Walter, H., Mokienko, V., Deutsch-russisches Wörterbuch biblischer Phraseologismen: mit historisch-etymologischen Kommentaren, Greifswald, Ernst-Moritz-Arndt- Universität, 2009.

Sitografia

Bible Gateway, www.biblegateway.com, (12.07.2020)
CORIS/CORDIS. Corpus di Italiano Scritto contemporaneo, www.corpora.ficlit.unibo.it (12/07/2020)
La Repubblica corpus, www.corpora.dipintra.it (12.07.2020)
Nacional’ny korpus russkogo jazyka, www.ruscorpora.ru, (12.07.2020)